Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetβ-Carbonic anhydrase (βCA)
LigandBDBM50010231
Substrate/Competitorn/a
Meas. Tech.CA Inhibition Assay
pH7.5±n/a
Temperature298.15±n/a K
Ki 7400±n/a nM
Commentsextracted
Citation Maresca, AVullo, DScozzafava, ASupuran, CT Inhibition of the alpha- and beta-carbonic anhydrases from the gastric pathogen Helycobacter pylori with anions. J Enzyme Inhib Med Chem28:388-91 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
β-Carbonic anhydrase (βCA)
Name:β-Carbonic anhydrase (βCA)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:25322.60
Organism:Helicobacter pylori
Description:Q08IJ2
Residue:218
Sequence:
MKAFLGALEFQENEYEELKELYESLKTKQKPHTLFISCVDSRVVPNLITGTKPGELYVIR
NMGNVIPPKTSHKESLSTMASIEYAIVHVGVQNLIICGHSDCGACGSTHLINDGTKAKTP
YIADWIQFLEPIKEELKNHPQFSNHFAKRSWLTERLNVRLQLNNLLSYDFIQERVVNNEL
KIFGWHYIIETGRIYNYNFESHFFEPIETKQRKSHENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010231
NameBDBM50010231
Synonyms:CHEMBL107217 | Ditiocarb sodium | Sodium salt of Diethyl-dithiocarbamic acid(DDC) | US9180183, DDTC | sodium N,N-diethyl-dithiocarbamate | sodium diethyldithiocarbamate
TypeSmall organic molecule
Emp. Form.C5H10NS2
Mol. Mass.148.27
SMILESCCN(CC)C([S-])=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a