Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase (AC)
LigandBDBM50431261
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH4.5±n/a
IC50 3400±n/a nM
Commentsextracted
Citation Piomelli, DRealini, NMor, MPagliuca, CPizzirani, DScarpelli, RBandiera, T Acid ceramidase inhibitors and their use as medicaments US Patent US9428465 Publication Date 8/30/2016
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase (AC)
Name:Acid ceramidase (AC)
Synonyms:AC | ACDase | Acid CDase | Acid ceramidase | Acylsphingosine deacylase | Asah1 | N-acylsphingosine amidohydrolase
Type:Enzyme
Mol. Mass.:44450.22
Organism:Rattus norvegicus (Rat)
Description:Q6P7S1
Residue:394
Sequence:
MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKR
WHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIAD
VTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEE
LKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMF
GKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKES
LDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTK
PVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431261
NameBDBM50431261
Synonyms:CHEMBL2333044 | US9428465, 11
TypeSmall organic molecule
Emp. Form.C12H20N4O3
Mol. Mass.268.3122
SMILESCCCCCCNC(=O)n1cc(NC)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a