Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase (AC)
LigandBDBM50431262
Substrate/Competitorn/a
Meas. Tech.Acid Ceramidase Activity Assay
pH4.5±n/a
IC50 35±n/a nM
Commentsextracted
Citation Piomelli, DRealini, NMor, MPagliuca, CPizzirani, DScarpelli, RBandiera, T Acid ceramidase inhibitors and their use as medicaments US Patent US9428465 Publication Date 8/30/2016
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase (AC)
Name:Acid ceramidase
Synonyms:Acid ceramidase
Type:Enzyme
Mol. Mass.:44662.65
Organism:Homo sapiens (Human)
Description:Q13510
Residue:395
Sequence:
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431262
NameBDBM50431262
Synonyms:CHEMBL2333042 | US9428465, 5
TypeSmall organic molecule
Emp. Form.C11H16BrN3O3
Mol. Mass.318.167
SMILESCCCCCCNC(=O)n1cc(Br)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a