Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome b-245 heavy chain
LigandBDBM244059
Substrate/Competitorn/a
Meas. Tech.Activity Assay
IC50 1000000000±n/a nM
Citation Ganesh, TSun, ASmith, SMLambeth, JD Piperazine derivatives, compositions, and uses related thereto US Patent US9428478 Publication Date 8/30/2016
More Info.:Get all data from this article,  Assay Method
 
Cytochrome b-245 heavy chain
Name:Cytochrome b-245 heavy chain
Synonyms:CGD91-phox | Cytochrome b(558) subunit beta | Cytochrome b-245, beta polypeptide [Homo sapiens] | Cytochrome b558 subunit beta | Heme-binding membrane glycoprotein gp91phox | NADPH oxidase 2 | NADPH oxidase 2 (NOX2) | NOX2 | Neutrophil cytochrome b 91 kDa polypeptide | Superoxide-generating NADPH oxidase heavy chain subunit | gp91-1 | gp91-phox | p22 phagocyte B-cytochrome
Type:Enzyme
Mol. Mass.:65355.82
Organism:Homo sapiens (Human)
Description:P04839
Residue:570
Sequence:
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM244059
NameBDBM244059
Synonyms:US9428478, TG6-167-2
TypeSmall organic molecule
Emp. Form.C19H22FN3O2
Mol. Mass.343.3953
SMILESCOc1ccc(cc1)N1CCN(CC1)C(=O)CNc1cccc(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a