Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTriosephosphate isomerase (TIM)
LigandBDBM246598
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±0
Temperature310.15±0 K
IC50 3.4e+4± 1e+3 nM
Citation Alvarez, GMartínez, JAguirre-López, BCabrera, NPérez-Díaz, Lde Gómez-Puyou, MTGómez-Puyou, APérez-Montfort, RGarat, BMerlino, AGonzález, MCerecetto, H New chemotypes as Trypanosoma cruzi triosephosphate isomerase inhibitors: a deeper insight into the mechanism of inhibition. J Enzyme Inhib Med Chem29:198-204 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Triosephosphate isomerase (TIM)
Name:Triosephosphate isomerase (TIM)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:26842.10
Organism:Trypanosoma brucei
Description:P04789
Residue:250
Sequence:
MSKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHLAMTKERLSHPKF
VIAAQNAIAKSGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASG
FMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATP
QQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKP
EFVDIIKATQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM246598
NameBDBM246598
Synonyms:TIM inhibitor, 3
TypeSmall organic molecule
Emp. Form.C22H17N3O5S
Mol. Mass.435.452
SMILES[#8-]-[#7+](=O)-c1ccc(\[#6]=[#6]-2/[#6](=O)-[#7](-[#6]-c3ccccc3)-[#16]-[#7](-[#6]-c3ccccc3)-[#6]-2=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a