Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFLT3(D835Y)
LigandBDBM247371
Substrate/Competitorn/a
Meas. Tech.KINOMEScan Technology Assays
Kd 14±n/a nM
Citation Blagg, JBavetsias, VMoore, ASLinardopoulos, S Pharmaceutically active compounds US Patent US9447092 Publication Date 9/20/2016
More Info.:Get all data from this article,  Assay Method
 
FLT3(D835Y)
Name:FLT3(D835Y)
Synonyms:FL cytokine receptor | Receptor-type tyrosine-protein kinase FLT3 (D835Y) | STK-1 | Stem cell tyrosine kinase 1 | Tyrosine Kinase FLT3 Mutant (D835Y)
Type:n/a
Mol. Mass.:112937.71
Organism:Homo sapiens (Human)
Description:P36888 D835Y
Residue:993
Sequence:
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARYIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM247371
NameBDBM247371
Synonyms:US9447092, 1
TypeSmall organic molecule
Emp. Form.C22H23Cl2N7
Mol. Mass.456.371
SMILESCc1nn(C)cc1-c1nc2c(N3CCN(Cc4ccc(Cl)cc4)CC3)c(Cl)cnc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a