Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
LigandBDBM249313
Substrate/Competitorn/a
Meas. Tech.Ligand KI Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 2.0±n/a nM
Commentsextracted
Citation Aktoudianakis, EChin, GCorkey, BKDu, JElbel, KJiang, RHKobayashi, TLee, RMartinez, RMetobo, SEMish, MMunoz, MShevick, SSperandio, DYang, HZablocki, J Benzimidazole derivatives as bromodomain inhibitors US Patent US9458145 Publication Date 10/4/2016
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Name:Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Synonyms:Bromodomain-containing protein 4 (BD1) | Bromodomain-containing protein 4 Bromodomain 1 (BRD4-1) | Bromodomain-containing protein 4 Domain 1
Type:n/a
Mol. Mass.:8856.55
Organism:Homo sapiens (Human)
Description:BD1 (75-147 aa) of O60885
Residue:73
Sequence:
WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFT
NCYIYNKPGDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM249313
NameBDBM249313
Synonyms:US9458145, 1020-289
TypeSmall organic molecule
Emp. Form.C24H25N5O3
Mol. Mass.431.487
SMILESCc1noc(C)c1-c1cc(c2nc([nH]c2c1)C1CC1)C(O)(C1CCCO1)c1cccnn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a