Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-carbonic anhydrase
LigandBDBM50010231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158306
pH7.5±n/a
Temperature293.15±n/a K
Ki 5000±n/a nM
Citation Del Prete, SVullo, DDe Luca, VCarginale, Vdi Fonzo, POsman, SMAlOthman, ZSupuran, CTCapasso, C Anion inhibition profiles of a-, - and -carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alpha-carbonic anhydrase
Name:Alpha-carbonic anhydrase
Synonyms:hpαCA
Type:Protein
Mol. Mass.:28337.60
Organism:Helicobacter pylori (strain G27)
Description:B5Z8I0
Residue:247
Sequence:
MKKTFLIALALTASLIGAENAKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KRSAETR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010231
NameBDBM50010231
Synonyms:CHEMBL107217 | Ditiocarb sodium | Sodium salt of Diethyl-dithiocarbamic acid(DDC) | US9180183, DDTC | sodium N,N-diethyl-dithiocarbamate | sodium diethyldithiocarbamate
TypeSmall organic molecule
Emp. Form.C5H10NS2
Mol. Mass.148.27
SMILESCCN(CC)C([S-])=S
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a