Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-carbonic anhydrase
LigandBDBM26980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158307
pH7.5±n/a
Temperature293.15±n/a K
Ki 28000000±n/a nM
Citation Del Prete, SVullo, DDe Luca, VCarginale, Vdi Fonzo, POsman, SMAlOthman, ZSupuran, CTCapasso, C Anion inhibition profiles of a-, - and -carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alpha-carbonic anhydrase
Name:Alpha-carbonic anhydrase
Synonyms:VchCA
Type:Protein
Mol. Mass.:26266.86
Organism:Vibrio cholerae
Description:A0A085T5X7
Residue:239
Sequence:
MKKTTWVLAMAASMSFGVQASEWGYEGEHAPEHWGKVAPLCAEGKNQSPIDVAQSVEADL
QPFTLNYQGQVVGLLNNGHTLQAIVSGNNPLQIDGKTFQLKQFHFHTPSENLLKGKQFPL
EAHFVHADEQGNLAVVAVMYQVGSESPLLKALTADMPTKGNSTQLTQGIPLADWIPESKH
YYRFNGSLTTPPCSEGVRWIVLKEPAHVSNQQEQQLSAVMGHNNRPVQPHNARLVLQAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26980
NameBDBM26980
Synonyms:BROMIDE | Br- | CHEMBL11685 | CHEMBL1644030 | CHEMBL1644694 | bromide | bromide ion
TypeIon
Emp. Form.Br
Mol. Mass.79.905
SMILES[Br-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a