Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM26981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158313
pH7.5±n/a
Temperature293.15±n/a K
Ki 6300000±n/a nM
Citation Del Prete, SVullo, DDe Luca, VCarginale, Vdi Fonzo, POsman, SMAlOthman, ZSupuran, CTCapasso, C Anion inhibition profiles of a-, - and -carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:VchγCA
Type:Protein
Mol. Mass.:19753.38
Organism:Vibrio cholerae
Description:A0A0H7HLM5
Residue:183
Sequence:
MSSIRSYKGIVPKLGEGVYIDSSAVLVGDIELGDDASIWPLVAARGDVNHIRIGKRTNIQ
DGSVLHVTHKNAENPNGYPLCIGDDVTIGHKVMLHGCTIHDRVLVGMGSIVLDGAVIEND
VMIGAGSLVPPGKRLESGFLYMGSPVKQARPLNDKERAFLVKSSSNYVQSKNDYLNDVKT
VRE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26981
NameBDBM26981
Synonyms:CHEMBL1644695 | CHEMBL185537 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
TypeIon
Emp. Form.I
Mol. Mass.126.90502
SMILES[I-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a