Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor 1
LigandBDBM256957
Substrate/Competitorn/a
Meas. Tech.Fluorescent Imaging Plate Reader (FLIPR) Assay
IC50 1±n/a nM
Citation Fieldhouse, CGlen, ARobinson, JSFujimoto, T Cyclopentylbenzamide derivatives and their use for the treatment of psychotic and cognitive disorders US Patent US9493432 Publication Date 11/15/2016
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor 1
Name:Orexin receptor 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM256957
NameBDBM256957
Synonyms:US9493432, 83
TypeSmall organic molecule
Emp. Form.C23H22FN5O2S
Mol. Mass.451.516
SMILESCN([C@H]1CCC[C@@H]1Nc1nc2ccc(F)cc2s1)C(=O)c1ccccc1-c1nc(C)no1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a