Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-adrenergic receptor kinase 1
LigandBDBM258600
Substrate/Competitorn/a
Meas. Tech.Competition Binding Assay
Temperature298.15±n/a K
IC50>30±n/a nM
Commentsextracted
Citation Akama, TJarnagin, KZhang, YZhou, YPlattner, JJSullivan, DC Boron-containing small molecules US Patent US9493490 Publication Date 11/15/2016
More Info.:Get all data from this article,  Assay Method
 
Beta-adrenergic receptor kinase 1
Name:Beta-adrenergic receptor kinase 1
Synonyms:ADRBK1 | BARK | BARK1 | Beta-ARK-1 | G-protein coupled receptor kinase 2 | G-protein coupled receptor kinase 2 (GRK2) | GRK2
Type:Enzyme
Mol. Mass.:79581.30
Organism:Homo sapiens (Human)
Description:P25098
Residue:689
Sequence:
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM258600
NameBDBM258600
Synonyms:US9493490, 6-(3-(aminomethyl)-2-fluorophenoxy)-7-methylbenzo[c][1,2]oxaborol-1(3H)-ol | US9493490, Example 12 | US9493490, M
TypeSmall organic molecule
Emp. Form.C15H15BFNO3
Mol. Mass.287.094
SMILESCc1c2B(O)OCc2ccc1Oc1cccc(CN)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a