Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRho-associated protein kinase 1 (ROCK I)
LigandBDBM14027
Substrate/Competitorn/a
Meas. Tech.Fluorescent Polarization Assay
Temperature296.15±n/a K
IC50 2100±200 nM
Commentsextracted
Citation McKerracher, LBond, LM Treatment of cerebral cavernous malformations and cerebral aneurysms with Rho kinase inhibitors US Patent US9687483 Publication Date 6/27/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Rho-associated protein kinase 1 (ROCK I)
Name:Rho-associated protein kinase 1 (ROCK I)
Synonyms:Liver regenerat ion-related protein LRRG199 | Liver regeneration-related protein LRRG199 | Rho-associated protein kinase 1 | Rho-associated, coiled-coil-containing protein kinase 1 | Rho-kinase (ROCK I) | p150 RhoA-binding kinase ROK beta | p160 ROCK-1
Type:Protein
Mol. Mass.:159610.34
Organism:Rattus norvegicus (Rat)
Description:Q63644
Residue:1369
Sequence:
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANPSENRSSSNV
DKNVQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESA
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNVENEVSTLKDQLEDLRKASQSSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNRELQERNRMLENSKSQAD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVETEKQCSMLDVDLKQSQQKLEHLTENKERLEDAVKSLTLQLEQES
NKRILLQSELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANNALTKDIELLRKENE
ELNERMRTAEEEYKLKKEEEISNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPVGSACIPYLFIFYSSSSRIEGWL
SVPNRGNIKRYGWKKQYVVVSSKKMLFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVY
RAETEEIPKIFQILYANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEAC
AKPLWHVFKPPPALECRRCHVKSHRDHLDKKEDLIPPCKVSYDVTSARDMLLLACPQDEQ
KKWVTHLVKKIPKKAPSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14027
NameBDBM14027
Synonyms:5-(1,4-diazepan-1-ylsulfonyl)isoquinoline | 5-(1,4-diazepane-1-sulfonyl)isoquinoline | AT877 | CHEMBL38380 | CHEMBL541388 | Fasudil (HA-1077) | HA-1077 | US9687483, Fasudil | cid_163751
TypeSmall organic molecule
Emp. Form.C14H17N3O2S
Mol. Mass.291.369
SMILESO=S(=O)(N1CCCNCC1)c1cccc2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a