Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM Kinase II
LigandBDBM6844
Substrate/CompetitorAutocamtide-2
Meas. Tech.CDK Kinase Inhibition Assay
IC50 177±n/a nM
Citation Engler, TAFurness, KMalhotra, SSanchez-Martinez, CShih, CXie, WZhu, GZhou, XConner, SFaul, MMSullivan, KAKolis, SPBrooks, HBPatel, BSchultz, RMDeHahn, TBKirmani, KSpencer, CDWatkins, SAConsidine, ELDempsey, JAOgg, CAStamm, NBAnderson, BDCampbell, RMVasudevan, VLytle, ML Novel, potent and selective cyclin D1/CDK4 inhibitors: indolo[6,7-a]pyrrolo[3,4-c]carbazoles. Bioorg Med Chem Lett13:2261-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CaM Kinase II
Name:CaM Kinase II
Synonyms:Calcium/calmodulin-dependent protein kinase type II, rat brain | calcium/calmodulin-dependent protein kinase II alpha subunit
Type:Enzyme Mixture
Mol. Mass.:54120.65
Organism:Rattus norvegicus (rat)
Description:Consists of subunits of M.W. 50,000 and 58,000-60,000 in a 3:1 ratio.
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6844
Autocamtide-2
Name:Autocamtide-2
Synonyms:n/a
Type:Peptide
Mol. Mass.:3697.73
Organism:n/a
Description:n/a
Residue:36
Sequence:
Lys-Lys-Ala-Leu-Arg-Arg-Gln-Glu-Thr-Val-Asp-Ala-Leu