Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK2 (aa808-1132)
LigandBDBM50021656
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.5±n/a
IC50 4.00±n/a nM
Commentsextracted
Citation Bursulaya, BFisch, ALajiness, JPMachauer, RMalekar, SPetrassi, HMRamazani, FRemond, AUllrich, TUsselmann, PVangrevelinghe, E Substituted indazoles for treating tendon and/or ligament injuries US Patent US10112907 Publication Date 10/30/2018
More Info.:Get all data from this article,  Assay Method
 
JAK2 (aa808-1132)
Name:JAK2 (aa808-1132)
Synonyms:n/a
Type:Protein
Mol. Mass.:39171.39
Organism:Homo sapiens (Human)
Description:n/a
Residue:335
Sequence:
FRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGK
GNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVC
YSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDL
ATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDV
WSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDE
IYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021656
NameBDBM50021656
Synonyms:BARICITINIB | INCB-028050 | LY-3009104 | US10112907, Example 00034
TypeSmall organic molecule
Emp. Form.C16H17N7O2S
Mol. Mass.371.417
SMILESCCS(=O)(=O)N1CC(CC#N)(C1)n1cc(cn1)-c1ncnc2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a