Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK1 (aa 837-1142)
LigandBDBM380422
Substrate/Competitorn/a
Meas. Tech.In Vitro JAK Kinase Assay
IC50<300±n/a nM
Citation Li, YZhuo, JQian, DMei, S Bipyrazole derivatives as JAK inhibitors US Patent US10435392 Publication Date 10/8/2019
More Info.:Get all data from this article,  Assay Method
 
JAK1 (aa 837-1142)
Name:JAK1 (aa 837-1142)
Synonyms:Tyrosine-protein kinase JAK1 | Tyrosine-protein kinase JAK1 (837-1142) | Tyrosine-protein kinase JAK1 (aa 837-1142)
Type:n/a
Mol. Mass.:35230.04
Organism:Homo sapiens (Human)
Description:n/a
Residue:306
Sequence:
FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDP
EGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIM
EFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQ
VKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLT
YCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQP
SNRTSF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM380422
NameBDBM380422
Synonyms:4-[3-(Cyanomethyl)-3-(3′-methyl-1H,1′H-4,4′-bipyrazol-1-yl)azetidin-1-yl]-N-isopropylbenzamide trifluoroacetate | US10435392, Example 3 | US9926301, Example 3
TypeSmall organic molecule
Emp. Form.C22H25N7O
Mol. Mass.403.4802
SMILESCC(C)NC(=O)c1ccc(cc1)N1CC(CC#N)(C1)n1cc(cn1)-c1c[nH]nc1C
Structure
n/a