Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK2 [828-1132]
LigandBDBM380445
Substrate/Competitorn/a
Meas. Tech.In Vitro JAK Kinase Assay
IC50 650±n/a nM
Citation Li, YZhuo, JQian, DMei, S Bipyrazole derivatives as JAK inhibitors US Patent US10435392 Publication Date 10/8/2019
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK2 [828-1132]
Name:Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:JAK2 (aa 828-1132) | Tyrosine-protein kinase JAK2
Type:n/a
Mol. Mass.:35579.28
Organism:Homo sapiens (Human)
Description:O60674[828-1132]
Residue:305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS
TEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKER
IDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEY
YKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGN
DKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIR
DNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM380445
NameBDBM380445
Synonyms:5-[3-(Cyanomethyl)-3-(3′,5′-dimethyl-1H,1′H-4,4′-bipyrazol-1-yl)azetidin-1-yl]-N-[(1S)-2,2,2-trifluoro-1-methylethyl]pyrazine-2-carboxamide trifluoroacetate | US10435392, Example 9 | US9926301, Example 9
TypeSmall organic molecule
Emp. Form.C21H22F3N9O
Mol. Mass.473.4543
SMILESC[C@H](NC(=O)c1cnc(cn1)N1CC(CC#N)(C1)n1cc(cn1)-c1c(C)n[nH]c1C)C(F)(F)F |r|
Structure
n/a