Target
Tyrosine-protein kinase JAK2 [828-1132]
Ligand
BDBM400514
Substrate
n/a
Meas. Tech.
In vitro JAK Kinase Assay
IC50
<10.00±n/a nM
Citation
 Huang, TXue, C Piperidin-4-yl azetidine derivatives as JAK1 inhibitors US Patent  US10695337 Publication Date 6/30/2020
Target
Name:
Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:
Tyrosine-protein kinase JAK2 (aa 828-1132)
Type:
Enzyme Catalytic Domain
Mol. Mass.:
35522.23
Organism:
Homo sapiens (Human)
Description:
aa 828-1132
Residue:
304
Sequence:
ALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
  
Inhibitor
Name:
BDBM400514
Synonyms:
US10695337, Example 270 | US11285140, Example 270 | US9999619, Example 270
Type:
Small organic molecule
Emp. Form.:
C27H24F3N7O
Mol. Mass.:
519.521
SMILES:
Fc1ccc(F)c(C(=O)N2CCC(CC2)N2CC(CC#N)(C2)n2ccc(c2)-c2ncnc3[nH]ccc23)c1F
Structure:
Search PDB for entries with ligand similarity: