Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM300297
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
Ki<1.00±n/a nM
Citation Fleury, MBeausoliel, AHughes, ADLong, DDWilton, DA Neprilysin inhibitors US Patent US9593110 Publication Date 3/14/2017
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CALLA | CD_antigen=CD10 | Common acute lymphocytic leukemia antigen | Enkephalinase | NEP | Neutral Endopeptidase (NEP) | Neutral endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85505.38
Organism:Homo sapiens (Human)
Description:P08473
Residue:750
Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM300297
NameBDBM300297
Synonyms:US9593110, 7-5
TypeSmall Organic Molecule
Emp. Form.C26H28ClFN2O5
Mol. Mass.502.962
SMILESCCOC[C@H](C[C@@H](Cc1ccc(cc1)-c1cc(Cl)ccc1F)NC(=O)c1cc(CC)no1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a