Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCystic fibrosis transmembrane conductance regulator
LigandBDBM300427
Substrate/Competitorn/a
Meas. Tech.YFP-Halide Influx Assay for the CFTR-WT
IC50>6670±n/a nM
Citation Akkari, RAlvey, LJBock, XMBrown, BSClaes, PICowart, MDConrath, KECyr, DDe Lemos, EDe Wilde, GJDesroy, NDuthion, BGfesser, GAGosmini, RLHousseman, CGJansen, KKJi, JKym, PRLefrancois, JMammoliti, OMenet, CJMerayo, NMNewsome, GJPalisse, AMPatel, SVPizzonero, MRShrestha, ASwift, ECTse, CVan der Plas, SEWang, X Compounds for treatment of cystic fibrosis US Patent US10130622 Publication Date 11/20/2018
More Info.:Get all data from this article,  Assay Method
 
Cystic fibrosis transmembrane conductance regulator
Name:Cystic fibrosis transmembrane conductance regulator
Synonyms:ABCC7 | ATP-binding cassette sub-family C member 7 | CFTR | Channel conductance-controlling ATPase | cAMP-dependent chloride channel
Type:Enzyme Catalytic Domain
Mol. Mass.:168171.30
Organism:Homo sapiens (Human)
Description:gi_90421313
Residue:1480
Sequence:
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRE
LASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGL
GRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA
YVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQT
WYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRK
TSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEG
KIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIV
LGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNS
ILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQ
MNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQG
QNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESI
PAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN
NSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAP
MSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATV
PVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHK
ALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIM
STLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK
DDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRL
LNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVAD
EVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVT
YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQA
ISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM300427
NameBDBM300427
Synonyms:US10130622, Example 00006
TypeSmall organic molecule
Emp. Form.C26H33N5O5S
Mol. Mass.527.636
SMILESCOCCS(=O)(=O)NC(=O)c1cc(N2CCC(CC2)OC)c2c(nn(-c3ccccc3)c2n1)C1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a