Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 1 (CDK1)
LigandBDBM7773
Substrate/CompetitorPeptide Substrate
Meas. Tech.Kinase Inhibition SPA Assay
IC50 19±n/a nM
Citation Bramson, HNCorona, JDavis, STDickerson, SHEdelstein, MFrye, SVGampe, RTHarris, PAHassell, AHolmes, WDHunter, RNLackey, KELovejoy, BLuzzio, MJMontana, VRocque, WJRusnak, DShewchuk, LVeal, JMWalker, DHKuyper, LF Oxindole-based inhibitors of cyclin-dependent kinase 2 (CDK2): design, synthesis, enzymatic activities, and X-ray crystallographic analysis. J Med Chem44:4339-58 (2001) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-Dependent Kinase 1 (CDK1)
Name:Cyclin-Dependent Kinase 1 (CDK1)
Synonyms:CDK1/B | CDK1/Cyclin B | CDK1/CyclinB | Cyclin B/Dependent Kinase 1 (CDK1) | Cyclin-dependent kinase 1/cyclin B1 | Cyclin-dependent kinase/G2/mitotic-specific cyclin 1 | cdk1
Type:Protein Complex
Mol. Mass.:n/a
Description:CDK1/Cyclin B complexes were purified from insect cells co-infected with baculovirus vectors containing each of the components.
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 1
Synonyms:Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | p34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:34101.08
Organism:Homo sapiens (Human)
Description:P06493
Residue:297
Sequence:
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:G2/mitotic-specific cyclin-B1
Synonyms:CCNB | CCNB1
Type:Enzyme Subunit
Mol. Mass.:48340.95
Organism:Homo sapiens (Human)
Description:P14635
Residue:433
Sequence:
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7773
NameBDBM7773
Synonyms:3-{[(2,2-Dioxido-1,3-dihydro-2-benzothien-5-yl)amino]-methylene}-5-(1,3-oxazol-5-yl)-1,3-dihydro-2H-indol-2-one | 5-({[(3Z)-5-(1,3-oxazol-5-yl)-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}amino)-1,3-dihydro-2-benzothiophene-2,2-dione | Oxindole-Based Inhibitor 109
TypeSmall organic molecule
Emp. Form.C20H15N3O4S
Mol. Mass.393.416
SMILESO=C1Nc2ccc(cc2C1C=Nc1ccc2CS(=O)(=O)Cc2c1)-c1cnco1 |w:10.11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Peptide Substrate
Name:Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:5198.94
Organism:n/a
Description:n/a
Residue:46
Sequence:
Biotin-aminohexyl-Ala-Arg-Arg-Pro-Met-Ser-Pro-Lys-Lys-Lys-Al
a-CONH2