BindingDB logo
myBDB logout
Details for Substrate PDKtide without Explicit Binding Affinity Data
Binding Enzyme 1: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (A162V)
Binding Enzyme 2: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (V143T/T222A)
Binding Enzyme 3: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (V143T)
Binding Enzyme 4: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (L159M)
Binding Enzyme 5: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (T222A)
Binding Enzyme 6: 3-phosphoinositide dependent protein kinase-1
Binding Enzyme 7: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Mutant (E166D)
Binding Enzyme 8: 3-phosphoinositide-dependent protein kinase 1 (51-359)
Synonyms:  Synthetic PDK substrate peptide
Type: Peptide
Topology: Linear
Mol. Mass.: 4766.24 Dalton
Organism: n/a
Description: n/a
Residue: 39
Sequence: KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC