BindingDB logo
myBDB logout
Details for Substrate cFMS -Tie-2 Chimera without Explicit Binding Affinity Data
Binding Enzyme 1: cFMS -Tie-2 Chimera
Synonyms:  6His.FMS.538-922(TIE2) | Tyrosine Kinase CSF1-R Mutant (Tie2 KID Chimera)
Type: Other Protein Type
Topology: Linear
Mol. Mass.: 37574.75 Dalton
Organism: Homo sapiens (human)
Description: Recombinant protein contains FMS cytoplasmic domain (FMS538-922.6His), in which FMS KID was replaced with Tie-2 KID.
Residue: 333
Sequence: GVDYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVA VKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKSRVLETDPAFAIANST ASTRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFD CVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSF LQEQAQEDRRERD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: