BindingDB logo
myBDB logout
Details for Substrate Serine/threonine-protein kinase Sgk1 without Explicit Binding Affinity Data
Binding Enzyme 1: 3-phosphoinositide dependent protein kinase-1
Binding Enzyme 2: 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1)
Synonyms:  SGK1 | Serine/threonine-protein kinase Sgk1 | Serine/threonine-protein kinase Sgk1 (SGK) | Serum/glucocorticoid regulated kinase | Serum/glucocorticoid-regulated kinase 1 (SGK1)
Type: Other Protein Type
Topology: Linear
Mol. Mass.: 48954.40 Dalton
Organism: Homo sapiens (human)
Description: Recombinant human SGK-1 enzyme produced in a baculovirus system.
Residue: 431
Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: