BindingDB logo
myBDB logout
Details for Substrate Dual specificity mitogen-activated protein kinase kinase 1 without Explicit Binding Affinity Data
Binding Enzyme 1: Mitogen-activated protein kinase kinase kinase 8
Binding Enzyme 2: RAF serine/threonine protein kinase
Binding Enzyme 3: B-RAF V600E
Synonyms:  GST fusion of MAP kinase kinase 1 | GST-MEK1 | glutathione S-transferase-MAP kinase kinase 1
Type: Other Protein Type
Topology: n/a
Mol. Mass.: 43453 Dalton
Organism: Oryctolagus cuniculus (rabbit)
Description: Rabbit MEK1 was purchased from Millipore.
Residue: 393
Sequence: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: