BindingDB logo
myBDB logout
Details for Substrate MEK1 (K97R) without Explicit Binding Affinity Data
Binding Enzyme 1: C-Raf TR (1-324)
Binding Enzyme 2: B-RAF V600E
Binding Enzyme 3: C-RAF
Synonyms:  n/a
Type: n/a
Topology: n/a
Mol. Mass.: 43467.04 Dalton
Organism: Human
Description: Biotinylated full length MEK1 with an inactivating K97R ATP binding site mutation.
Residue: 393
Sequence: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARRLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: