BindingDB logo
myBDB logout
Details for Substrate His6-tagged MCM2 without Explicit Binding Affinity Data
Binding Enzyme 1: Cdc7 Kinase
Synonyms:  DNA replication licensing factor MCM2 | Minichromosome maintenance protein 2 homolog | Nuclear protein BM28
Type: Other Protein Type
Topology: n/a
Mol. Mass.: 52558.30 Dalton
Organism: Homo sapiens (human)
Description: n/a
Residue: 467
Sequence: MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: