BindingDB logo
myBDB logout
Details for Substrate Biotin-GST-c-JUN without Explicit Binding Affinity Data
Binding Enzyme 1: c-Jun N-terminal kinase, JNK
Synonyms:  n/a
Type: Other Protein Type
Topology: n/a
Mol. Mass.: 8641.27 Dalton
Organism: Rattus norvegicus (rat)
Description: GST-c-Jun (1-79) fusion protein was biotinylated.
Residue: 79
Sequence: MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: