BindingDB logo
myBDB logout
Details for Substrate biotin-tagged SRC-1 without Explicit Binding Affinity Data
Binding Enzyme 1: Bile acid receptor FXR
Synonyms:  Steroid receptor coactivator 1 (amino acids 568-780)
Type: Other Protein Type
Topology: n/a
Mol. Mass.: 23127.68 Dalton
Organism: Homo sapiens (human)
Description: n/a
Residue: 213
Sequence: NSPSRLNIQPAKAESKDNKEIASILNEMIQSDN SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: