BindingDB logo
myBDB logout
Details for Substrate Biotinyl-BCCP without Explicit Binding Affinity Data
Binding Enzyme 1: Biotin Carboxylase
Synonyms:  AccB | Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Type: biotin binding protein
Topology: n/a
Mol. Mass.: 16678.47 Dalton
Organism: Escherichia coli (strain K12)
Description: n/a
Residue: 156
Sequence: MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSN AAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA MKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: