Compile Data Set for Download or QSAR
maximum 50k data
Found 58 with Last Name = 'song' and Initial = 'cl'
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  1nMAssay Description:Inhibition of human full length recombinant YES using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  2nMAssay Description:Inhibition of human recombinant ABL (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human full length recombinant Src using Cdc2 peptide as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant ABL T315I mutant (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human HCK (230 to 497 residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human recombinant RET (658 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ra...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human recombinant ARG (38 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human full length recombinant LYN using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  6nMAssay Description:Inhibition of human recombinant TXK (256 to end residues) using GEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ra...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  6nMAssay Description:Inhibition of human full length recombinant FYN using Cdc2 peptide as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  7nMAssay Description:Inhibition of human recombinant FGFR1 (456 to 765 residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  9nMAssay Description:Inhibition of human full length recombinant CSK using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  10nMAssay Description:Inhibition of human recombinant TIE2 Q939H/Q940H mutant (771 to end residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence o...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  14nMAssay Description:Inhibition of human full length recombinant LCK using KVEKIGEGTYGVVYK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  15nMAssay Description:Inhibition of human recombinant FLT1 (783 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P-ATP] by r...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  16nMAssay Description:Inhibition of human full length recombinant BLK M287V mutant using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  19nMAssay Description:Inhibition of human recombinant PTK5 (218 to end residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  19nMAssay Description:Inhibition of human recombinant EGFR T790M mutant (696 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gam...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  21nMAssay Description:Inhibition of human full length recombinant BMX using poly (Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometr...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  30nMAssay Description:Inhibition of Src in human MDA-MB-231 cells assessed as reduction in phosphorylation of Src incubated for 20 hrs by Western blot analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  32nMAssay Description:Inhibition of human recombinant KDR (790 to end residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P-ATP]...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  40nMAssay Description:Inhibition of human recombinant FGFR2 N549H mutant (456 to 770 residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gam...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  50nMAssay Description:Inhibition of human recombinant TAK1 (1 to 313 residues) using casein as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  52nMAssay Description:Inhibition of human recombinant c-RAF Y340D/Y341D mutant (306 to end residues) using inactive MEK1 as substrate incubated for 40 mins in presence of ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  65nMAssay Description:Inhibition of human recombinant DDR2 S642A mutant (467 to end residues) using KKSRGDYMTMQIG as substrate incubated for 40 mins in presence of [gamma3...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 11(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  84nMAssay Description:Inhibition of human full length recombinant p38beta using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ra...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  87nMAssay Description:Inhibition of human recombinant B-RAF V600E mutantMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  110nMAssay Description:Inhibition of human recombinant B-Raf (416 to end residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P-AT...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  116nMAssay Description:Inhibition of human full length recombinant PYK2 using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometr...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  120nMAssay Description:Inhibition of human recombinant FGFR3 (447 to 761 residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  121nMAssay Description:Inhibition of human full length recombinant BRK using poly (Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometr...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  122nMAssay Description:Inhibition of human recombinant ERBB4 (706 to 991 residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using [protein fragment, 39 aa] incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  165nMAssay Description:Inhibition of human recombinant ERBB2 G778D mutant (676 to end residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [ga...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  175nMAssay Description:Inhibition of human recombinant ACK1 (1 to 389 residues) using EFPIYDFLPAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  227nMAssay Description:Inhibition of human recombinant EPHA4 (601 to 892 residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  255nMAssay Description:Inhibition of human recombinant LIMK1 (285 to 638 residues) using cofilin as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiome...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 14(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  342nMAssay Description:Inhibition of human full length recombinant p38alpha using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P-ATP] by r...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  351nMAssay Description:Inhibition of human recombinant RSE (451 to end residues) using KVEKIGEGTYGVVYK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by r...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  559nMAssay Description:Inhibition of human full length recombinant RSK1 using KKKNRTLSVA as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378887(US10266537, Compound 31)
Affinity DataIC50:  600nMAssay Description:Inhibition of human ERG expressed in CHO cells at -80 mV holding potential by automated Qpatch electrophysiological assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  651nMAssay Description:Inhibition of human recombinant EGFR (696 to end residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50563830(CHEMBL4783566)
Affinity DataIC50:  680nMAssay Description:Inhibition of human ERG expressed in CHO cells at -80 mV holding potential by automated Qpatch electrophysiological assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  899nMAssay Description:Inhibition of human recombinant TRKB (455 to end residues) using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  1.29E+3nMAssay Description:Inhibition of human recombinant PDGFRalpha (550 to end residues) using poly(Glu, Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50563829(CHEMBL4799744)
Affinity DataIC50:  2.38E+3nMAssay Description:Inhibition of human ERG expressed in CHO cells at -80 mV holding potential by automated Qpatch electrophysiological assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50563828(CHEMBL4793811)
Affinity DataIC50:  5.62E+3nMAssay Description:Inhibition of human ERG expressed in CHO cells at -80 mV holding potential by automated Qpatch electrophysiological assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human full length recombinant ERK2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human recombinant PDGFRbeta (557 to end residues) using poly(Glu, Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-A...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human recombinant RSK2 (2 to end residues) using KKKNRTLSVA as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiome...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 58 total ) | Next | Last >>
Jump to: