Compile Data Set for Download or QSAR
maximum 50k data
Found 843 with Last Name = 'xiang' and Initial = 'r'
TargetLysine-specific demethylase 4D(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50574750(CHEMBL4850758)
Affinity DataKi:  293nMAssay Description:Mixed inhibition of human KDM4D expressed in Escherichia coli BL21(DE3) using H3(1-21)K9me3 peptide and varying concentrations of 2-OG as substrate p...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50021574(BMS-907351 | CABOZANTINIB | CHEBI:72317 | Cabomety...)
Affinity DataIC50:  0.0350nMAssay Description:Inhibition of VEGFR2 phosphorylation (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM13216(BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-...)
Affinity DataIC50:  0.300nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedDrugBank

TargetAurora kinase B(Homo sapiens (Human))
Lanzhou University

Curated by ChEMBL
LigandPNGBDBM50543551(CHEMBL4633715)
Affinity DataIC50:  0.370nMAssay Description:Inhibition of Aurora B in human SW620 cells assessed as reduction in histone H3 phosphorylation on Ser10 by Alexafluor-488 goat anti-rabbit antibody/...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244935(CHEMBL4094507)
Affinity DataIC50:  0.530nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Lanzhou University

Curated by ChEMBL
LigandPNGBDBM50004205(MK-045 | MK-0457 | TOZASERTIB | US9249124, VX680 |...)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of recombinant human N-terminal His6-tagged Aurora A expressed in baculovirus expression system by enzyme coupled assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086441(CHEMBL3426225 | US10266537, Compound 3)
Affinity DataIC50:  0.800nMAssay Description:Inhibition of human YesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244933(CHEMBL4069404)
Affinity DataIC50:  0.840nMAssay Description:Binding affinity at [3H]QNB and GppNHp radiolabeled muscarinic M2 receptor in rat heart.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086441(CHEMBL3426225 | US10266537, Compound 3)
Affinity DataIC50:  0.900nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086454(CHEMBL3425518)
Affinity DataIC50:  1nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  1nMAssay Description:Inhibition of human full length recombinant YES using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Lanzhou University

Curated by ChEMBL
LigandPNGBDBM50004205(MK-045 | MK-0457 | TOZASERTIB | US9249124, VX680 |...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of Aurora kinase A (unknown origin) incubated for 30 mins by Kinase Glo luminescent assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Lanzhou University

Curated by ChEMBL
LigandPNGBDBM50277545(4-(9-chloro-7-(2-fluoro-6-methoxyphenyl)-5H-benzo[...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of recombinant Aurora A (unknown origin) by radioactive flashplate assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244900(CHEMBL4068308)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244881(CHEMBL4102249)
Affinity DataIC50:  1.60nMAssay Description:Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244849(CHEMBL4083345)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy

Curated by ChEMBL
LigandPNGBDBM50238867(CHEMBL4083249)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy

Curated by ChEMBL
LigandPNGBDBM50238867(CHEMBL4083249)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086451(CHEMBL3426222)
Affinity DataIC50:  2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086455(CHEMBL3426219)
Affinity DataIC50:  2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086457(CHEMBL3426217)
Affinity DataIC50:  2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  2nMAssay Description:Inhibition of human recombinant ABL (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy

Curated by ChEMBL
LigandPNGBDBM50533659(CHEMBL4444648)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244953(CHEMBL4063500)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244826(CHEMBL4074698)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50322535(3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N...)
Affinity DataIC50:  3nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedDrugBank

TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086453(CHEMBL3426220 | US10266537, Compound 14)
Affinity DataIC50:  3nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244956(CHEMBL4091353)
Affinity DataIC50:  3nMAssay Description:Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50243924(CHEMBL4075931)
Affinity DataIC50:  3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50243953(CHEMBL4101340)
Affinity DataIC50:  3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50243948(CHEMBL4096248)
Affinity DataIC50:  3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human full length recombinant Src using Cdc2 peptide as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human HCK (230 to 497 residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant ABL T315I mutant (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetHistone deacetylase 1(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244883(CHEMBL4067088)
Affinity DataIC50:  3.10nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086450(CHEMBL3426223)
Affinity DataIC50:  4nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086456(CHEMBL3426218 | US10266537, Compound 17)
Affinity DataIC50:  4nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50243973(CHEMBL4064699)
Affinity DataIC50:  4nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human recombinant RET (658 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ra...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50243960(CHEMBL4083691)
Affinity DataIC50:  4nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human full length recombinant LYN using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  4nMAssay Description:Inhibition of human recombinant ARG (38 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50244937(CHEMBL4104221)
Affinity DataIC50:  4.80nMAssay Description:Inhibition of recombinant human full length N-terminal GST-tagged CDK4/Cyclin-D3 co-expressed in baculovirus infected sf21 cells using Rb substrate i...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086441(CHEMBL3426225 | US10266537, Compound 3)
Affinity DataIC50:  5nMAssay Description:Inhibition of human FynMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy

Curated by ChEMBL
LigandPNGBDBM50533653(CHEMBL4519741)
Affinity DataIC50:  5nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50086586(CHEMBL3426234 | US10266537, Compound 29)
Affinity DataIC50:  5nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy

Curated by ChEMBL
LigandPNGBDBM50238882(CHEMBL4094600)
Affinity DataIC50:  6nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy

Curated by ChEMBL
LigandPNGBDBM50238882(CHEMBL4094600)
Affinity DataIC50:  6nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy

Curated by ChEMBL
LigandPNGBDBM50533672(CHEMBL4448466)
Affinity DataIC50:  6nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nankai University

Curated by ChEMBL
LigandPNGBDBM50519562(CHEMBL4592737)
Affinity DataIC50:  6nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 843 total ) | Next | Last >>
Jump to: