Affinity DataKi: 293nMAssay Description:Mixed inhibition of human KDM4D expressed in Escherichia coli BL21(DE3) using H3(1-21)K9me3 peptide and varying concentrations of 2-OG as substrate p...More data for this Ligand-Target Pair
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 0.0350nMAssay Description:Inhibition of VEGFR2 phosphorylation (unknown origin)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 0.300nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
Affinity DataIC50: 0.370nMAssay Description:Inhibition of Aurora B in human SW620 cells assessed as reduction in histone H3 phosphorylation on Ser10 by Alexafluor-488 goat anti-rabbit antibody/...More data for this Ligand-Target Pair
Affinity DataIC50: 0.530nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:Inhibition of recombinant human N-terminal His6-tagged Aurora A expressed in baculovirus expression system by enzyme coupled assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMAssay Description:Inhibition of human YesMore data for this Ligand-Target Pair
Affinity DataIC50: 0.840nMAssay Description:Binding affinity at [3H]QNB and GppNHp radiolabeled muscarinic M2 receptor in rat heart.More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 0.900nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human full length recombinant YES using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Affinity DataIC50: 1.10nMAssay Description:Inhibition of Aurora kinase A (unknown origin) incubated for 30 mins by Kinase Glo luminescent assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.20nMAssay Description:Inhibition of recombinant Aurora A (unknown origin) by radioactive flashplate assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.40nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1.60nMAssay Description:Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15More data for this Ligand-Target Pair
Affinity DataIC50: 1.60nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of human recombinant ABL (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 2.20nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 2.60nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of human full length recombinant Src using Cdc2 peptide as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric sc...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human HCK (230 to 497 residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometric ...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human recombinant ABL T315I mutant (27 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-...More data for this Ligand-Target Pair
Affinity DataIC50: 3.10nMAssay Description:Inhibition of HDAC1 (unknown origin)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human recombinant RET (658 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P-ATP] by ra...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of N-terminal FLAG-tagged recombinant human mTOR (1362 to end residues)More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of human full length recombinant LYN using poly(Glu,Tyr)4:1 as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radiometri...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of human recombinant ARG (38 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma33P-ATP] by radio...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Nankai University
Curated by ChEMBL
Nankai University
Curated by ChEMBL
Affinity DataIC50: 4.80nMAssay Description:Inhibition of recombinant human full length N-terminal GST-tagged CDK4/Cyclin-D3 co-expressed in baculovirus infected sf21 cells using Rb substrate i...More data for this Ligand-Target Pair
Affinity DataIC50: 5nMAssay Description:Inhibition of human FynMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Sichuan University
Curated by ChEMBL
Sichuan University
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human SrcMore data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Sichuan University And Collaborative Innovation Center For Biotherapy
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant human CLK1 expressed in insect cells using ERMRPRKRQGSVRRRV peptide as substrate after 40 mins in presence of [gamma-33P]-A...More data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Sichuan University/Collaborative Innovation Center Of Biotherapy
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant human N-terminal GST-tagged FLT3 (564 to end residues) expressed by baculovirus in Sf21 insect cells measured after 10 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair