Compile Data Set for Download or QSAR
maximum 50k data
Found 62 with Last Name = 'hembree' and Initial = 'j'
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324711(CHEMBL1222085)
Affinity DataEC50:  0.0770nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324710(CHEMBL1222084)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324713(CHEMBL1222087 | HSQGTFTSDYSKYLDEQAAKEFIAWLMNT)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324714(CHEMBL1222088)
Affinity DataEC50:  0.0480nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324715(CHEMBL1222089)
Affinity DataEC50:  0.0870nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324716(CHEMBL1222090)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324717(CHEMBL1222091)
Affinity DataEC50:  0.0730nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324718(CHEMBL1222092)
Affinity DataEC50:  0.0800nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324719(CHEMBL1222093 | HAEGTFTSDVSSYLEERRAQDFVQWLMNT)
Affinity DataEC50:  50nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324720(CHEMBL1222094)
Affinity DataEC50:  3.70nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324721(CHEMBL1222095)
Affinity DataEC50:  2.40nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324722(CHEMBL1222096)
Affinity DataEC50: >1.00E+3nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324723(CHEMBL1222097)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324724(CHEMBL1222098)
Affinity DataEC50:  0.0460nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324725(CHEMBL1222099)
Affinity DataEC50:  0.0580nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324726(CHEMBL1222100)
Affinity DataEC50:  0.0780nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324727(CHEMBL1222101)
Affinity DataEC50:  0.0760nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324728(CHEMBL1222102)
Affinity DataEC50:  0.590nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324729(CHEMBL1222174)
Affinity DataEC50:  0.0550nMAssay Description:Agonist activity at GCGR expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50098571(CHEMBL266481 | GLUCAGON | His-Ser-Gln-Gly-Thr-Phe-...)
Affinity DataEC50:  3.30nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324731(CHEMBL1222074 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR)
Affinity DataEC50:  0.0330nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324732(CHEMBL1222075)
Affinity DataEC50:  0.600nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324702(CHEMBL1222076)
Affinity DataEC50:  0.170nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324703(CHEMBL1222077)
Affinity DataEC50:  1.10nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324704(CHEMBL1222078)
Affinity DataEC50:  0.230nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324705(CHEMBL1222079)
Affinity DataEC50:  0.260nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324706(CHEMBL1222080)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324707(CHEMBL1222081)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324708(CHEMBL1222082)
Affinity DataEC50:  0.570nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324709(CHEMBL1222083)
Affinity DataEC50:  0.580nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324710(CHEMBL1222084)
Affinity DataEC50:  0.580nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324711(CHEMBL1222085)
Affinity DataEC50:  0.0710nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324712(CHEMBL1222086 | HSQGTFTSDYSKYLDEQAAKEFIAWLVKG)
Affinity DataEC50:  0.0150nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324713(CHEMBL1222087 | HSQGTFTSDYSKYLDEQAAKEFIAWLMNT)
Affinity DataEC50:  0.0260nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324714(CHEMBL1222088)
Affinity DataEC50:  0.0750nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324715(CHEMBL1222089)
Affinity DataEC50:  0.0280nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324716(CHEMBL1222090)
Affinity DataEC50:  0.0750nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324717(CHEMBL1222091)
Affinity DataEC50:  0.0680nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324718(CHEMBL1222092)
Affinity DataEC50:  0.0870nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324719(CHEMBL1222093 | HAEGTFTSDVSSYLEERRAQDFVQWLMNT)
Affinity DataEC50:  0.180nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324720(CHEMBL1222094)
Affinity DataEC50:  0.110nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324721(CHEMBL1222095)
Affinity DataEC50:  0.0280nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324722(CHEMBL1222096)
Affinity DataEC50:  0.0110nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324723(CHEMBL1222097)
Affinity DataEC50:  0.130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324724(CHEMBL1222098)
Affinity DataEC50:  0.0510nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324725(CHEMBL1222099)
Affinity DataEC50:  0.0490nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324726(CHEMBL1222100)
Affinity DataEC50:  0.240nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324727(CHEMBL1222101)
Affinity DataEC50:  0.180nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324728(CHEMBL1222102)
Affinity DataEC50:  0.0140nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Indiana University

Curated by ChEMBL
LigandPNGBDBM50324729(CHEMBL1222174)
Affinity DataEC50:  0.0130nMAssay Description:Agonist activity at GLP1R expressed in HEK293 cells assessed as stimulation of cAMP production by luciferase reporter gene assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 62 total ) | Next | Last >>
Jump to: