Compile Data Set for Download or QSAR
maximum 50k data
Found 1955 with Last Name = 'ling' and Initial = 'l'
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)
Affinity DataKi:  0.0200nMAssay Description:Inhibition of ROS1 (unknown origin) by Pfizer mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018836(CHEMBL3286826)
Affinity DataKi: <0.0200nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)
Affinity DataKi: <0.0200nMAssay Description:Inhibition of ROS1 (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018837(CHEMBL3286827)
Affinity DataKi: <0.0700nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)
Affinity DataKi: <0.0700nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018836(CHEMBL3286826)
Affinity DataKi: <0.0800nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018838(CHEMBL3286828)
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018825(CHEMBL3286815)
Affinity DataKi: <0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018829(CHEMBL3286819)
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A2a(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317007(2-amino-4-(furan-2-yl)-5H-indeno[1,2-d]pyrimidin-5...)
Affinity DataKi:  0.100nMAssay Description:Antagonist activity at adenosine A2A receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018833(CHEMBL3286823)
Affinity DataKi:  0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018835(CHEMBL3286825)
Affinity DataKi:  0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A2a(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50161342(2-Amino-4-phenyl-indeno[1,2-d]pyrimidin-5-one | 2-...)
Affinity DataKi:  0.100nMAssay Description:Antagonist activity at adenosine A2A receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018828(CHEMBL3286818)
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018839(CHEMBL3286829)
Affinity DataKi: <0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018838(CHEMBL3286828)
Affinity DataKi:  0.120nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018823(CHEMBL3286813)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018818(CHEMBL3128075)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018821(CHEMBL3286811)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018835(CHEMBL3286825)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018833(CHEMBL3286823)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
TargetAdenosine receptor A2a(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317008(2-amino-4-(5-chlorofuran-2-yl)-5H-indeno[1,2-d]pyr...)
Affinity DataKi:  0.200nMAssay Description:Antagonist activity at adenosine A2A receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)
Affinity DataKi:  0.200nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018832(CHEMBL3286822)
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018825(CHEMBL3286815)
Affinity DataKi:  0.220nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)
Affinity DataKi:  0.290nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Abbott Laboratories

Curated by ChEMBL
LigandPNGBDBM50255960(4-(6-methylpyridin-2-yl)-5-(quinoxalin-6-yl)thiazo...)
Affinity DataKi:  0.330nMAssay Description:Binding affinity to human TGFBR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018824(CHEMBL3286814)
Affinity DataKi:  0.360nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018826(CHEMBL3286816)
Affinity DataKi:  0.380nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018839(CHEMBL3286829)
Affinity DataKi:  0.400nMAssay Description:Inhibition of TRKB (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A1(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317007(2-amino-4-(furan-2-yl)-5H-indeno[1,2-d]pyrimidin-5...)
Affinity DataKi:  0.400nMAssay Description:Antagonist activity at adenosine A1 receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018837(CHEMBL3286827)
Affinity DataKi:  0.400nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPolycomb protein EED(Homo sapiens (Human))
Abbvie

LigandPNGBDBM223987(A-395 (5) | rac-(3R,4S)-1-(7-fluoro-2,3-dihydro-1H...)
Affinity DataKi:  0.400nM ΔG°:  -53.6kJ/molepH: 7.5 T: 2°CAssay Description:For the assay, compounds were dispensed in assay-ready plates using a three-fold serial dilution from 50 μM to ~850 pM using an Echo 550 Acousti...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPolycomb protein EED(Homo sapiens (Human))
Abbvie

LigandPNGBDBM223987(A-395 (5) | rac-(3R,4S)-1-(7-fluoro-2,3-dihydro-1H...)
Affinity DataKi:  0.5nM ΔG°:  -53.1kJ/molepH: 7.5 T: 2°CAssay Description:For the assay, compounds were dispensed in assay-ready plates using a three-fold serial dilution from 50 μM to ~850 pM using an Echo 550 Acousti...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A1(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317008(2-amino-4-(5-chlorofuran-2-yl)-5H-indeno[1,2-d]pyr...)
Affinity DataKi:  0.5nMAssay Description:Antagonist activity at adenosine A1 receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A2a(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317011(2-amino-4-(thiazol-2-yl)-5H-indeno[1,2-d]pyrimidin...)
Affinity DataKi:  0.5nMAssay Description:Antagonist activity at adenosine A2A receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)
Affinity DataKi:  0.5nMAssay Description:Inhibition of TRKB (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018842(CHEMBL3286832)
Affinity DataKi:  0.560nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018828(CHEMBL3286818)
Affinity DataKi:  0.570nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine receptor A2a(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research And Development

Curated by ChEMBL
LigandPNGBDBM50317010(2-amino-4-(thiophen-2-yl)-5H-indeno[1,2-d]pyrimidi...)
Affinity DataKi:  0.600nMAssay Description:Antagonist activity at adenosine A2A receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018829(CHEMBL3286819)
Affinity DataKi:  0.620nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018821(CHEMBL3286811)
Affinity DataKi:  0.700nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)
Affinity DataKi:  0.700nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Abbott Laboratories

Curated by ChEMBL
LigandPNGBDBM50255959(4-(5-fluoro-6-methylpyridin-2-yl)-5-(quinoxalin-6-...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity to human TGFBR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50306682((R)-3-(1-(2,6-dichloro-3-fluorophenyl)ethoxy)-5-(1...)
Affinity DataKi:  0.740nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
Displayed 1 to 50 (of 1955 total ) | Next | Last >>
Jump to: