Compile Data Set for Download or QSAR
maximum 50k data
Found 4903 with Last Name = 'tan' and Initial = 'v'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274351(2-(6,8-Dichloro-2-(4-nitrophenyl)imidazo[1,2-a]pyr...)
Affinity DataKi:  0.150nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50521920(CHEMBL4469545)
Affinity DataKi:  0.200nMAssay Description:Displacement of [3H]-CP55940 from human CB1 receptor expressed in CHO cell membranesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50159077(2-[6,8-Dichloro-2-(4-chloro-phenyl)-imidazo[1,2-a]...)
Affinity DataKi:  0.203nMAssay Description:Displacement of [3H]-PK11195 from peripheral benzodiazepine receptor of rat cerebral cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274260(2-(6,8-Dichloro-2-(4-methoxyphenyl)imidazo[1,2-a]p...)
Affinity DataKi:  0.230nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274403(2-(6,8-Dichloro-2-(4-chloro-3-nitrophenyl)imidazo[...)
Affinity DataKi:  0.240nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50516264(CHEMBL4463013)
Affinity DataKi:  0.260nMAssay Description:Displacement of [3H]CP55940 from human CB1 receptor expressed in HEK293 cell membranesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274404(CHEMBL521180 | N-Butyl-2-(6,8-dichloro-2-(4-chloro...)
Affinity DataKi:  0.300nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50159075(CHEMBL180210 | N-Butyl-2-[6,8-dichloro-2-(4-chloro...)
Affinity DataKi:  0.302nMAssay Description:Displacement of [3H]-PK11195 from peripheral benzodiazepine receptor of rat cerebral cortexMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274258(2-(6,8-Dichloro-2-(4-methoxyphenyl)imidazo[1,2-a]p...)
Affinity DataKi:  0.310nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274219(2-(6,8-Dichloro-2-(4-hydroxyphenyl)imidazo[1,2-a]p...)
Affinity DataKi:  0.320nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364980(CHEMBL1950775)
Affinity DataKi:  0.320nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364980(CHEMBL1950775)
Affinity DataKi:  0.320nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274406(2-(2-(3-Amino-4-chlorophenyl)-6,8-dichloroimidazo[...)
Affinity DataKi:  0.330nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364981(CHEMBL1950776)
Affinity DataKi:  0.330nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145818(US8952177, 174 | US9089569, 174 | US9695149, 174)
Affinity DataKi:  0.340nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145818(US8952177, 174 | US9089569, 174 | US9695149, 174)
Affinity DataKi:  0.340nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145818(US8952177, 174 | US9089569, 174 | US9695149, 174)
Affinity DataKi:  0.340nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364981(CHEMBL1950776)
Affinity DataKi:  0.360nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364981(CHEMBL1950776)
Affinity DataKi:  0.360nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 6(Homo sapiens (Human))
Amri

Curated by ChEMBL
LigandPNGBDBM50364980(CHEMBL1950775)
Affinity DataKi:  0.370nMAssay Description:Displacement of [3H]LSD from human 5-HT6 serotonin receptor by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50521917(CHEMBL4520650)
Affinity DataKi:  0.380nMAssay Description:Displacement of [3H]-CP55940 from human CB1 receptor expressed in CHO cell membranesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM22032(1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoq...)
Affinity DataKi:  0.400nMAssay Description:Displacement of [3H]PK11195 from TSPO in rat C6 cell membrane after 90 mins by radioligand binding assayMore data for this Ligand-Target Pair
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50463404(CHEMBL4244751)
Affinity DataKi:  0.400nMAssay Description:Displacement of [3H]-CP55940 from human CB1 receptor expressed in HEK293 cell membranes after 1 hr by liquid scintillation spectrometryMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145820(US8952177, 176 | US9089569, 176 | US9695149, 176)
Affinity DataKi:  0.420nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145820(US8952177, 176 | US9089569, 176 | US9695149, 176)
Affinity DataKi:  0.420nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145820(US8952177, 176 | US9089569, 176 | US9695149, 176)
Affinity DataKi:  0.420nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTranslocator protein(Rattus norvegicus (rat))
Universita Degli Studi Di Bari

Curated by ChEMBL
LigandPNGBDBM50274406(2-(2-(3-Amino-4-chlorophenyl)-6,8-dichloroimidazo[...)
Affinity DataKi:  0.450nMAssay Description:Displacement of [3H]PK11195 from peripheral benzodiazepine receptor in Sprague-Dawley rat cerebral cortex membrane by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145785(US8952177, 139 | US9089569, 139 | US9695149, 139)
Affinity DataKi:  0.470nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145785(US8952177, 139 | US9089569, 139 | US9695149, 139)
Affinity DataKi:  0.470nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145785(US8952177, 139 | US9089569, 139 | US9695149, 139)
Affinity DataKi:  0.470nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145770(US8952177, 124 | US9089569, 124 | US9695149, 124)
Affinity DataKi:  0.520nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145770(US8952177, 124 | US9089569, 124 | US9695149, 124)
Affinity DataKi:  0.520nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145770(US8952177, 124 | US9089569, 124 | US9695149, 124)
Affinity DataKi:  0.520nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataKi:  0.570nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50521900(CHEMBL4580498)
Affinity DataKi:  0.600nMAssay Description:Displacement of [3H]-CP55940 from human CB1 receptor expressed in CHO cell membranesMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Rti International

Curated by ChEMBL
LigandPNGBDBM50463413(CHEMBL4242477)
Affinity DataKi:  0.600nMAssay Description:Displacement of [3H]-CP55940 from human CB1 receptor expressed in HEK293 cell membranes after 1 hr by liquid scintillation spectrometryMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145769(US8952177, 123 | US9089569, 123 | US9695149, 123)
Affinity DataKi:  0.610nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145769(US8952177, 123 | US9089569, 123 | US9695149, 123)
Affinity DataKi:  0.610nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145769(US8952177, 123 | US9089569, 123 | US9695149, 123)
Affinity DataKi:  0.610nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145782(US8952177, 136 | US9089569, 136 | US9695149, 136)
Affinity DataKi:  0.640nMAssay Description:FLAP-containing membranes were prepared as was a FITC-labeled FLAP modulator (3-(3-(tert-butylthio)-1-(4-chlorobenzyl)-5-(quinolin-2-ylmethoxy)-1H-in...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145782(US8952177, 136 | US9089569, 136 | US9695149, 136)
Affinity DataKi:  0.640nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetArachidonate 5-lipoxygenase-activating protein(Homo sapiens (Human))
Janssen Pharmaceutica

US Patent
LigandPNGBDBM145782(US8952177, 136 | US9089569, 136 | US9695149, 136)
Affinity DataKi:  0.640nMAssay Description:The assay below is used to test the modulatory activity of compounds against FLAP. Human and mouse FLAP-encoding DNA was amplified by polymerase chai...More data for this Ligand-Target Pair
In DepthDetails US Patent
Displayed 1 to 50 (of 4903 total ) | Next | Last >>
Jump to: