Found 7 of ic50 for monomerid = 394583 
Affinity DataIC50: 8.90nMAssay Description:Inhibition of PBRM1 bromodomain 5 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 8.90nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvpr\gsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSEL...More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of His-tagged SMARCA4 (unknown origin) (1448 to 1575 residues) using biotinylated ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG...More data for this Ligand-Target Pair
3D Structure (crystal)TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataIC50: 37nMAssay Description:Inhibition of SMARCA2 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
TargetIsoform Short of Probable global transcription activator SNF2L2 (Short) 377-1486](Homo sapiens (Human))
Genentech
US Patent
Genentech
US Patent
Affinity DataIC50: 37.3nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvpr\gsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQL...More data for this Ligand-Target Pair
Affinity DataIC50: 38.7nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
TargetBromodomain-containing protein 4(Homo sapiens (Human))
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataIC50: 2.70E+4nMAssay Description:Inhibition of BRD4 bromodomain 1 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
