BindingDB logo
myBDB logout

Search by Compound Name


Compound Name:

Compounds Sorted by Binding Data per Compound

1   2   3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   
22   23   24   25   26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   
43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   
64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   
85   86   87   88   89   90   91   92   93   94   95   96   97   98   99   100   101   102   103   104   105   
106   108   109   110   111   112   113   114   115   116   117   118   119   120   121   123   124   125   126   127   128   
129   130   131   132   133   134   135   137   138   139   140   142   143   144   146   148   150   152   153   154   155   
157   158   159   160   161   162   163   164   166   168   171   173   174   177   178   182   183   185   186   188   189   
190   191   194   198   199   202   203   204   207   209   213   217   221   223   224   232   233   237   238   239   241   
249   251   253   262   271   273   277   282   285   286   292   295   303   305   307   308   320   325   330   333   335   
336   337   338   344   349   360   370   378   389   397   413   425   430   435   442   443   444   445   446   447   448   
450   453   456   457   458   460   461   463   465   466   467   468   471   472   475   479   480   482   498   512   513   
521   530   535   541   558   593   622   637   644   793   804   821   825   831   834   841   848   851   852   854   856   
868   883   887   892   913   923   924   938   939   994   999   1011   1013   1027   1031   1047   1070   1072   1099   1125   1196   
1484   1506   1618   1796   
Compounds Sorted Alphabetically
Compound Name
(alphabetical)
Enz. Inhib. DataITC DataBinding TargetsAlternate Compound Names
KiIC50KdEC50KoffKonOther
BDBM15211
PNG
1523400000
  • Axin-1/Glycogen synthase kinase-3 beta
  • CAMK2B
  • CaM-kinase kinase beta
  • Casein kinase I isoform alpha
  • Casein kinase II alpha (prime)
  • Casein kinase II subunit alpha
  • Myosin light chain kinase
  • Myosin light chain kinase, smooth muscle
  • PKA
  • Protein kinase C alpha type
  • Protein kinase Pfmrk
  • RAC-alpha serine/threonine-protein kinase
  • Rho-associated protein kinase 2
  • Rho-associated protein kinase 2 (ROCK II)
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase AKT
  • Serine/threonine-protein kinase AKT2
  • cAMP-Dependent Protein Kinase (PKA)
  • cAMP-dependent protein kinase (PKA)
  • cGMP-dependent protein kinase
  • CHEMBL104264
  • H-89
  • H89
  • HT-89 (H-89)
  • N-(2-{[(2E)-3-(4-bromophenyl)prop-2-en-1-yl]amino}ethyl)isoquinoline-5-sulfonamide
  • N-[2-[[(E)-3-(4-bromophenyl)prop-2-enyl]amino]ethyl]isoquinoline-5-sulfonamide
BDBM18137
PNG
11145101100
  • 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
  • 5'-AMP-activated protein kinase Complex 1
  • ADORA3
  • Adenosine Receptors A2a (A2a)
  • Adenosine receptor A1
  • Adenylate kinase 1
  • Adenylate kinase 2
  • Axin-1/Glycogen synthase kinase-3 beta
  • Cholecystokinin
  • Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl)
  • Fructose-1,6-bisphosphatase 1 (FBPase)
  • Human immunodeficiency virus type 1 protease
  • Inosine-5'-monophosphate dehydrogenase
  • Ketopantoate reductase
  • Mitogen-activated protein kinase kinase kinase 7
  • P2Y purinoceptor 1
  • Phospholipase C, gamma 1
  • Phospholipase C-beta-3
  • Proto-oncogene tyrosine-protein kinase Src
  • Purinergic receptor P2Y1
  • Purinergic receptor P2Y11
  • Purinergic receptor P2Y2
  • Transient receptor potential cation channel subfamily M member 2
  • tRNA synthetase (GlyRS)
  • AMP
  • CHEMBL752
  • [(2R,3S,4R,5R)-5-adenin-9-yl-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl dihydrogen phosphate;hydrate
  • adenosine 5 -monophosphate
  • {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid
BDBM191598
PNG
040200000
  • Homo sapiens lysine demethylase 2A (KDM2A)
  • Lysine-specific demethylase 2B
  • Lysine-specific demethylase 3A
  • Lysine-specific demethylase 3B (KDM3B)
  • Lysine-specific demethylase 4A
  • Lysine-specific demethylase 4A (KDM4A)
  • Lysine-specific demethylase 4B
  • Lysine-specific demethylase 4C
  • Lysine-specific demethylase 5A
  • Lysine-specific demethylase 5A (KDM5A(aa 1-1090)-Flag)
  • Lysine-specific demethylase 5A (KDM5A(aa 1-588)ΔAP)
  • Lysine-specific demethylase 5A (KDM5A(aa 1-739)ΔAP(2C-2S))
  • Lysine-specific demethylase 5A (KDM5A)
  • Lysine-specific demethylase 5B
  • Lysine-specific demethylase 5B (KDM5B(aa 1-604)ΔAP)
  • Lysine-specific demethylase 5B (KDM5B(aa 1-755)ΔAP)
  • Lysine-specific demethylase 5C
  • Lysine-specific demethylase 5C (KDM5C(aa 1-789)ΔAP)
  • Lysine-specific demethylase 5C (KDM5C)
  • Lysine-specific demethylase 5D (KDM5D(aa 1-760)ΔAP)
  • Lysine-specific demethylase 5D (KDM5D)
  • Lysine-specific demethylase 6A
  • Lysine-specific demethylase 6B
  • 2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid (KDM5-C49)
  • KDM5-C49
  • KDOAM-20
BDBM21724
PNG
030390000
  • Bile acid receptor
  • Bile acid receptor FXR
  • 3-[(E)-2-(2-chloro-4-{[3-(2,6-dichlorophenyl)-5-(1-methylethyl)isoxazol-4-yl]methoxy}phenyl)ethenyl]benzoic acid
  • 3-[(E)-2-(2-chloro-4-{[3-(2,6-dichlorophenyl)-5-(propan-2-yl)-1,2-oxazol-4-yl]methoxy}phenyl)ethenyl]benzoic acid
  • CHEMBL318457
  • GW-4064
BDBM23163
PNG
5100270000
  • Sphingosine 1-Phosphate Receptor 2
  • Sphingosine 1-Phosphate Receptor 4
  • Sphingosine 1-phosphate receptor
  • Sphingosine 1-phosphate receptor 1
  • Sphingosine 1-phosphate receptor 3
  • Sphingosine 1-phosphate receptor 5
  • CHEMBL114606
  • FTY720-phosphate, rac-2
  • {2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy}phosphonic acid
BDBM23420
PNG
832100000
  • 12-Lipoxygenase (12-LOX)
  • 3C-like proteinase (3CL-PRO)
  • Aldehyde dehydrogenase, mitochondrial
  • Aldo-keto reductase family member 1B10 (AKR1B10)
  • Aldose reductase
  • Alpha-glucosidase MAL62
  • Arachidonate 15-lipoxygenase
  • Calcium channel
  • Carbonic anhydrase 1
  • Carbonic anhydrase 12
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 7
  • Cytochrome P450 19A1
  • Epidermal growth factor receptor
  • Estradiol receptor beta (ERβ)
  • Estrogen receptor
  • Estrogen receptor beta
  • Fatty acid synthase
  • Neuraminidase
  • Tyrosinase
  • Urease subunit beta
  • Uridine-5'-diphosphoglucuronosyltransferase 1A1
  • Xanthine dehydrogenase/oxidase
  • alpha-Amylase
  • 7,4′-Dihydroxy-isoflavone (3a)
  • 7-hydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one
  • CHEMBL8145
  • Daidzein
  • US8552057, 7
BDBM24466
PNG
1428000000
  • Angiopoietin-1 receptor
  • Aurora kinase A/Targeting protein for Xklp2
  • Aurora kinase B
  • Cyclin-Dependent Kinase 5 (CDK5)
  • Fibroblast growth factor receptor 1
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • Macrophage-stimulating protein receptor
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 14
  • Mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase 9
  • Proto-oncogene tyrosine-protein kinase Src
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • RAC-alpha serine/threonine-protein kinase
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • SRC
  • Serine/threonine-protein kinase AKT2
  • Serine/threonine-protein kinase pim-1
  • Serine/threonine-protein kinase pim-2
  • Tyrosine Kinase c-Met
  • Tyrosine Kinase c-Met Mutant (D1228H)
  • Tyrosine Kinase c-Met Mutant (H1094R)
  • Tyrosine Kinase c-Met Mutant (M1250T)
  • Tyrosine Kinase c-Met Mutant (V1092I)
  • Tyrosine Kinase c-Met Mutant (Y1230H)
  • Tyrosine-protein kinase ABL1
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Vascular endothelial growth factor receptor 2
  • cAMP-dependent protein kinase (PKA)
  • 1-(2-hydroxy-2-methylpropyl)-N-{5-[(7-methoxyquinolin-4-yl)oxy]pyridin-2-yl}-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide
  • Substituted Pyrazolone, 17
BDBM28701
PNG
330360000
  • Bile salt export pump
  • Bile salt export pump (BSEP)
  • Intestinal fatty acid-binding protein (hIFABP)
  • Liver fatty acid binding protein (rat L-FABP)
  • Organic anion-transporting polypeptide 1D1 (Oatp1d1)
  • Peroxisome proliferator-activated receptor
  • Peroxisome proliferator-activated receptor alpha
  • Peroxisome proliferator-activated receptor alpha (PPAR alpha)
  • Peroxisome proliferator-activated receptor delta
  • Peroxisome proliferator-activated receptor gamma
  • 2-(4-{2-[(4-chlorophenyl)formamido]ethyl}phenoxy)-2-methylpropanoic acid
  • Azufibrat
  • Bezafibrate
  • CHEMBL264374
  • Cedur
  • Sklerofibrat
BDBM320017
PNG
042000000
  • Cytochrome P450 1A
  • Cytochrome P450 2C8
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6
  • Cytochrome P450 3A
  • P2X purinoceptor 2
  • P2X purinoceptor 3
  • P2X2/3
  • Trans Isomer 1; 3- (5-chloro-1,3- thiazol-2-yl)-5-{[3- hydroxybutan-2- yl]oxy}-N-{(1R)-1- [2-(trifluoromethyl) pyrimidin-5-yl]ethyl} benzamide
  • US10174016, Example 184
  • US10174016, Example 185
  • US10174016, Example 187
  • US10174016, Example 188
  • US10202369, Example 188
  • US10472354, Example 188
BDBM35440
PNG
140100000
  • Dual Specificity Protein Phosphatase 1
  • MKP-3
  • Purine nucleoside phosphorylase
  • Xanthine dehydrogenase
  • Xanthine dehydrogenase/oxidase
  • ALLOPURINOL
  • MLS000069453
  • SMR000059083
  • cid_2094
BDBM50004923
PNG
2244120000
  • 5-hydroxytryptamine receptor 2A
  • Adenylate cyclase
  • Alpha-2C adrenergic receptor
  • D(1A) dopamine receptor
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • DOPAMINE
  • Dopamine D1B
  • Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Dopamine D5 receptor
  • Dopamine receptor
  • Dopamine receptors; D1 & D2
  • POsterior Segregation family member (pos-1)
  • RecName: Full=Zinc finger protein mex-5
  • Replicase polyprotein 1ab
  • adrenergic Alpha2
  • (+/-)-SKF-38393
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol (SK&F 38393)
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol(SKF 38393)
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol; hydrochloride(SKF 38393)
  • CHEMBL286080
  • CHEMBL505308
  • CHEMBL542700
  • RS(+/-)SKF 383931-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol
  • SK&F-38393
  • SK-38393
  • SKF 38393
  • SKF-38393
  • US9359372, SKF38393
  • cid_147514
BDBM50010594
PNG
2022000000
  • 5-hydroxytryptamine receptor 2A
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • D(4) dopamine receptor
  • DOPAMINE
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Dopamine receptor
  • Muscarinic acetylcholine receptor
  • Muscarinic acetylcholine receptor M1
  • Serotonin 2 (5-HT2) receptor
  • Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
  • Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(isoclozapine)
  • CHEMBL415300
  • ISOCLOZAPINE
BDBM50015490
PNG
329010000
  • NPFF
  • NPFF2
  • NPY2R
  • NPY5R
  • Neuropeptide Y
  • Neuropeptide Y receptor type 1
  • Neuropeptide Y receptor type 2
  • Neuropeptide Y receptor type 5 ( NPY Y5)
  • Neuropeptide Y receptor type 5 (NPY Y5)
  • PPYR1
  • CHEMBL438945
  • H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • NPY
  • NPY, human
  • NPY, human, rat
  • Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY)
  • human Neuropeptide Y
BDBM50024294
PNG
043800000
  • AP2-associated protein kinase 1
  • Aurora kinase A/Targeting protein for Xklp2
  • BMP-2-inducible protein kinase
  • CaM kinase I alpha
  • CaM kinase I delta
  • CaM kinase I gamma
  • CaM-kinase kinase beta
  • Casein kinase I
  • Casein kinase I delta/epsilon
  • Cyclin-dependent kinase 2
  • Death-associated protein kinase 2
  • Death-associated protein kinase 3
  • Dual specificity protein kinase CLK2
  • Dual specificity protein kinase CLK4
  • Dual specificity protein kinase TTK
  • Ephrin type-A receptor 3 (EPHA3)
  • MAP kinase-interacting serine/threonine-protein kinase 2
  • MAP/microtubule affinity-regulating kinase 2
  • Mitogen-activated protein kinase 10
  • Mitogen-activated protein kinase 12
  • Mitogen-activated protein kinase 9
  • Phosphorylase kinase
  • Ribosomal protein S6 kinase alpha 2
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase 17A
  • Serine/threonine-protein kinase 2
  • Serine/threonine-protein kinase 38-like
  • Serine/threonine-protein kinase 4 (STK4)
  • Serine/threonine-protein kinase Aurora-C
  • Serine/threonine-protein kinase GAK
  • Serine/threonine-protein kinase MST2
  • Serine/threonine-protein kinase PCTAIRE-1
  • Serine/threonine-protein kinase PLK4
  • Serine/threonine-protein kinase pim-2
  • TRAF2 and NCK-interacting protein kinase (TNIK)
  • Tyrosine-protein kinase STK16 (STK16)
  • ULK3 kinase
  • c-Jun N-terminal kinase, JNK
  • SP-600125
BDBM50051293
PNG
2810400000
  • Bile salt export pump
  • Cytochrome P450 1A
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 3A
  • Mu-type opioid receptor
  • Neurokinin 3 receptor
  • Neuromedin-K receptor
  • Substance-K receptor
  • Substance-P receptor
  • TACR3
  • (S)-(-)-N-(R-ethylbenzyl)-3-hydroxy-2-phenylquinoline-4-carboxamide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid ((S)-1-phenyl-propyl)-amide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid (1-phenyl-propyl)-amide
  • CHEMBL10188
  • SB 223412
  • SB-2234
  • SB-223412
  • Talnetant
BDBM50161646
PNG
1000320000
  • 5-hydroxytryptamine receptor 2A
  • 5-hydroxytryptamine receptor 2B
  • 5-hydroxytryptamine receptor 2C
  • HTR2C
  • Sodium-dependent dopamine transporter
  • Sodium-dependent noradrenaline transporter
  • Sodium-dependent serotonin transporter
  • (1R)-8-chloro-2,3,4,5-tetrahydro-1-methyl-1H-3-benzazepine
  • (R)-8-Chloro-1-methyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine
  • CHEMBL360328
  • LORCASERIN
BDBM50278323
PNG
420000000
  • α-Carbonic anhydrase (αCA)
  • β-Carbonic anhydrase (βCA)
  • Alpha-carbonic anhydrase
  • Astrosclerin-3
  • Beta-carbonic anhydrase
  • Carbonic Anhydrase XIII
  • Carbonic anhydrase
  • Carbonic anhydrase 1
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 7
  • Gamma-carbonic anhydrase
  • CHEMBL471245
  • sodium trithiocarbonate
BDBM50337910
PNG
042000000
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 3A
  • Monoamine transporter
  • Monoamine transporters; Norepinephrine & serotonin
  • Monoamine transporters; Norepininephrine & dopamine
  • Neuroepithelial cell-transforming 1
  • Neuroepithelial cell-transforming gene 1 protein
  • Potassium voltage-gated channel subfamily H member 2
  • Sodium-dependent dopamine transporter
  • Sodium-dependent noradrenaline transporter
  • Sodium-dependent serotonin transporter
  • (+/-)-1-(1-(3,4-dichlorophenyl)cyclohexyl)-N-methylethanamine
  • 1-(1-(3,4-dichlorophenyl)cyclohexyl)-N-methylethanamine
  • CHEMBL1684045
  • CHEMBL1684057
  • US10562878, Compound 108
BDBM50354578
PNG
2650110000
  • Delta-type opioid receptor
  • Kappa-type opioid receptor
  • Mu-type opioid receptor
  • Nociceptin receptor
  • Nociceptin/mu opioid receptor
  • Opioid receptor
  • Opioid receptors; mu & delta
  • Potassium voltage-gated channel subfamily H member 2
  • BUPRENORPHINE
  • US9315514, Buprenorphine
BDBM50413752
PNG
042000000
  • ALK tyrosine kinase receptor
  • Aurora kinase A/Targeting protein for Xklp2
  • Axin-1/Glycogen synthase kinase-3 beta
  • Cyclin-dependent kinase 2
  • Dual specificity mitogen-activated protein kinase kinase 2
  • Dual specificity mitogen-activated protein kinase kinase 6
  • Dual specificity mitogen-activated protein kinase kinase; MEK1/2
  • Ephrin receptor
  • Ephrin type-B receptor 4
  • Fibroblast growth factor receptor 3
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • MAP kinase-activated protein kinase 5
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 1
  • Mitogen-activated protein kinase 14
  • Non-receptor tyrosine-protein kinase TYK2
  • Protein kinase N1
  • Protein kinase N2
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1)
  • Receptor tyrosine-protein kinase erbB-2
  • Rho-associated protein kinase 2
  • SRC
  • Serine/threonine-protein kinase receptor R3
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Tyrosine-protein kinase ZAP-70
  • Tyrosine-protein kinase receptor FLT3
  • Tyrosine-protein kinase receptor UFO
  • Vascular endothelial growth factor receptor 2
  • Vascular endothelial growth factor receptor 3
  • cAMP-dependent protein kinase (PKA)
  • CHEMBL2012519
  • L-783277
BDBM50455480
PNG
093300000
  • ATPase family AAA domain-containing protein 2
  • Bromodomain adjacent to zinc finger domain protein 2A
  • Bromodomain adjacent to zinc finger domain protein 2B
  • Bromodomain and PHD finger-containing protein 3
  • Bromodomain and WD repeat-containing protein 1
  • Bromodomain testis-specific protein
  • Bromodomain-containing protein 1
  • Bromodomain-containing protein 2
  • Bromodomain-containing protein 3
  • Bromodomain-containing protein 4
  • Bromodomain-containing protein 7
  • Bromodomain-containing protein 8
  • Bromodomain-containing protein 9
  • CREB-binding protein
  • Cat eye syndrome critical region protein 2
  • E3 ubiquitin-protein ligase TRIM33
  • HIF1A/p300/CREB-binding protein
  • Histone acetyltransferase KAT2A/KAT2B
  • Nucleosome-remodeling factor subunit BPTF
  • Peregrin
  • Probable global transcription activator SNF2L2
  • Protein polybromo-1
  • Transcription activator BRG1
  • Transcription initiation factor TFIID subunit 1
  • Transcription initiation factor TFIID subunit 1-like
  • Transcription intermediary factor 1-alpha
  • CHEMBL4218735