BDBM50033809 CHEMBL3358151
SMILES C[C@]1(CNC(=O)COc2ccc(Cl)cc2)NC(=O)NC1=O
InChI Key InChIKey=LNIRXDCIYOBRPL-CYBMUJFWSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 8 hits for monomerid = 50033809
Affinity DataIC50: >5.00E+4nMAssay Description:Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 74nMAssay Description:Inhibition of human ADAMTS-4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 350nMAssay Description:Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 70nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.40E+4nMAssay Description:Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
Affinity DataIC50: 7.00E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 620nMAssay Description:Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay in presence of 50% rat plasmaMore data for this Ligand-Target Pair