Compile Data Set for Download or QSAR
maximum 50k data
Found 412 of ic50 for UniProtKB: A0A024R6K1
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466226(CHEMBL4293213)
Affinity DataIC50:  2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525743(US11174252, Compound 38)
Affinity DataIC50:  2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525738(US11174252, Compound 33)
Affinity DataIC50:  2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466217(CHEMBL4287416)
Affinity DataIC50:  2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM126500(US11591322, Compound NVP-2 | US8778951, 310)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50363196(CHEMBL1944698)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525750(US11174252, Compound 437)
Affinity DataIC50:  4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525729(US11174252, Compound 24)
Affinity DataIC50:  4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525730(US11174252, Compound 25)
Affinity DataIC50:  5nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466210(CHEMBL4281048)
Affinity DataIC50:  6nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466216(CHEMBL4291684)
Affinity DataIC50:  9nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466238(CHEMBL4277623)
Affinity DataIC50:  10nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466240(CHEMBL4286005)
Affinity DataIC50:  12nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM50059889((staurosporine)3-methoxy-2-methyl-4-methylamino-(2...)
Affinity DataIC50:  13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50433369(CHEMBL2377825)
Affinity DataIC50:  13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466222(CHEMBL4279576)
Affinity DataIC50:  14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466218(CHEMBL4278245)
Affinity DataIC50:  14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466221(CHEMBL4281710)
Affinity DataIC50:  17nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466235(CHEMBL4282838)
Affinity DataIC50:  22nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466219(CHEMBL4293383)
Affinity DataIC50:  27nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466212(CHEMBL4287488)
Affinity DataIC50:  28nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  39nMAssay Description:Inhibition of human CDK9/Cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50538150(CHEMBL4647703)
Affinity DataIC50:  40nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525755(US11174252, Compound 442)
Affinity DataIC50:  41nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466225(CHEMBL4278079)
Affinity DataIC50:  51nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50538119(CHEMBL4633552)
Affinity DataIC50:  51nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM50367676(CHEMBL4160662)
Affinity DataIC50:  52nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK12 (1 to 1490 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50110183(Abemaciclib | LY-2835219 | US10626107, Example LY2...)
Affinity DataIC50:  65nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 9(Homo sapiens (Human))
Nuvation Bio

US Patent
LigandPNGBDBM525749(US11174252, Compound 436)
Affinity DataIC50:  73nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen™ Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466233(CHEMBL4285545)
Affinity DataIC50:  80nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466213(CHEMBL4290724)
Affinity DataIC50:  84nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466239(CHEMBL4276761)
Affinity DataIC50:  90nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466232(CHEMBL4288923)
Affinity DataIC50:  94nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Chinese Academy Of Sciences

Curated by ChEMBL
LigandPNGBDBM50466220(CHEMBL4277182)
Affinity DataIC50:  96nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479046((R)-N-(4-(3-((5-chloro-4- (dimethylamino)pyrimidin...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479048((R)-N-(4-(3-((5-chloro-4-(2- methoxyethoxy)pyrimid...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479050((R)-N-(4-(3-((4-amino-5- chloropyrimidin-2- yl)ami...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479051((R)-N-(4-(3-((4-amino-5- (trifluoromethyl)pyrimidi...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479052((R)-N-(4-(3-((5-chloro-4- (trifluoromethyl)pyrimid...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479007((R)-N-(4-(3-((5-chloro-4- methoxypyrimidin-2- yl)a...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479055((R)-N-(4-(3-((5-chloro-4- phenoxypyrimidin-2- yl)a...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479056((R)-N-(4-(3-((5-chloro-4- ethoxypyrimidin-2- yl)am...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479062((R)-N-(4-(3-((5-chloro-4-(2- cyanoethoxy)pyrimidin...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479064((R)-N-(4-(3-((5-bromopyrimidin-2- yl)amino)pyrroli...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM479022((R)-N-(4-(3-((5-chloro-4- (methylamino)pyrimidin-2...)
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM572075((R)-2-((1-(4- acrylamidobenzoyl)pyrrolidin-3- yl)a...)
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM572094((R)-N,N-dimethyl-2-((1-(4- propionamidobenzoyl)pyr...)
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM572095((R)-N-(4-(3-((7-oxo-7,8- dihydropyrido[2,3-d]pyrim...)
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM572096((R)-N-(4-(3-((8-isopropyl-7-oxo-7,8- dihydropyrido...)
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical

Curated by ChEMBL
LigandPNGBDBM572097((R)-N-(2-fluoro-4-(3-(quinazolin-2- ylamino)pyrrol...)
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
Displayed 1 to 50 (of 412 total ) | Next | Last >>
Jump to: