Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression systemMore data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 5nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 17nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 22nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 27nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 28nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of human CDK9/Cyclin K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
Affinity DataIC50: 40nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Affinity DataIC50: 41nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 51nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 51nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: 52nMAssay Description:Inhibition of N-terminal FLAG-tagged human full-length CDK12 (1 to 1490 residues)/N-terminal His-tagged CycK (1 to 580 residues) expressed in Sf9 cel...More data for this Ligand-Target Pair
Affinity DataIC50: 65nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Affinity DataIC50: 73nMAssay Description:CDK9 (cyclin K): IC50 values of compounds against CDK9 (cyclin K) were determined by LanthaScreen Eu Kinase Binding Assay at Invitrogen Life Te...More data for this Ligand-Target Pair
Affinity DataIC50: 80nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 84nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 90nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 94nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Affinity DataIC50: 96nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:The IC50 profile of test compounds was determined using three protein kinases. IC50 values were measured by testing 10 concentrations (1×10−04M...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair
TargetCyclin-K/Cyclin-dependent kinase 12(Homo sapiens (Human))
Takeda Pharmaceutical
Curated by ChEMBL
Takeda Pharmaceutical
Curated by ChEMBL
Affinity DataIC50: <100nMAssay Description:A radiometric protein kinase assay (33PanQinaseŽ Activity Assay) was used for measuring the kinase activity of the three protein kinases. All kinase ...More data for this Ligand-Target Pair