Compile Data Set for Download or QSAR
maximum 50k data
Found 496 of ic50 data for polymerid = 5138
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337721(CHEMBL1683454 | N-((2S,4S)-1-(4-(4-fluoro-2-methyl...)
Affinity DataIC50:  0.180nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337721(CHEMBL1683454 | N-((2S,4S)-1-(4-(4-fluoro-2-methyl...)
Affinity DataIC50:  0.180nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337735(CHEMBL1615187 | N-[(2S,4S)-1-({4-[2-(3,5-dimethyl-...)
Affinity DataIC50:  0.260nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337722(CHEMBL1683460 | N-((2S,4S)-1-(4-(2-(3,5-dimethylis...)
Affinity DataIC50:  0.260nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337723(CHEMBL1683450 | N-((2S,4S)-1-(4-(4-chloro-2-methyl...)
Affinity DataIC50:  0.360nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337723(CHEMBL1683450 | N-((2S,4S)-1-(4-(4-chloro-2-methyl...)
Affinity DataIC50:  0.360nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337724(CHEMBL1683458 | N-((2S,4S)-1-(4-(2-(2,5-dimethylpy...)
Affinity DataIC50:  0.430nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337724(CHEMBL1683458 | N-((2S,4S)-1-(4-(2-(2,5-dimethylpy...)
Affinity DataIC50:  0.430nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337726(CHEMBL1683451 | N-((2S,4S)-1-(4-(2-bromo-4-fluorop...)
Affinity DataIC50:  0.480nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337725(CHEMBL1683449 | N-((2S,4S)-1-(4-(2-chloro-4-(trifl...)
Affinity DataIC50:  0.480nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337727(CHEMBL1683457 | N-((2S,4S)-1-(4-(2,5-dimethylphene...)
Affinity DataIC50:  0.480nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337727(CHEMBL1683457 | N-((2S,4S)-1-(4-(2,5-dimethylphene...)
Affinity DataIC50:  0.480nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337726(CHEMBL1683451 | N-((2S,4S)-1-(4-(2-bromo-4-fluorop...)
Affinity DataIC50:  0.480nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337725(CHEMBL1683449 | N-((2S,4S)-1-(4-(2-chloro-4-(trifl...)
Affinity DataIC50:  0.480nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337736(CHEMBL1683455 | N-((2S,4S)-4-(5-fluoropyrimidin-2-...)
Affinity DataIC50:  0.490nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337736(CHEMBL1683455 | N-((2S,4S)-4-(5-fluoropyrimidin-2-...)
Affinity DataIC50:  0.490nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337731(CHEMBL1683453 | N-((2S,4S)-1-(4-(4-fluoro-2-(trifl...)
Affinity DataIC50:  0.520nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337731(CHEMBL1683453 | N-((2S,4S)-1-(4-(4-fluoro-2-(trifl...)
Affinity DataIC50:  0.520nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337734(CHEMBL1683464 | N-((2S,4S)-1-(4-(2-chloro-4-(methy...)
Affinity DataIC50:  0.570nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337734(CHEMBL1683464 | N-((2S,4S)-1-(4-(2-chloro-4-(methy...)
Affinity DataIC50:  0.570nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337739(CHEMBL1683461 | N-((2S,4S)-1-(4-(2-(4,6-dimethylpy...)
Affinity DataIC50:  0.680nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337739(CHEMBL1683461 | N-((2S,4S)-1-(4-(2-(4,6-dimethylpy...)
Affinity DataIC50:  0.680nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337735(CHEMBL1615187 | N-[(2S,4S)-1-({4-[2-(3,5-dimethyl-...)
Affinity DataIC50:  0.690nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337735(CHEMBL1615187 | N-[(2S,4S)-1-({4-[2-(3,5-dimethyl-...)
Affinity DataIC50:  0.690nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337743(CHEMBL1683456 | N-((2S,4S)-1-(4-(2-cyclopropyl-4-(...)
Affinity DataIC50:  0.940nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337743(CHEMBL1683456 | N-((2S,4S)-1-(4-(2-cyclopropyl-4-(...)
Affinity DataIC50:  0.940nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50168737((2R,3R)-1-[4-(2-Chloro-4-fluoro-benzyloxy)-benzene...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50168737((2R,3R)-1-[4-(2-Chloro-4-fluoro-benzyloxy)-benzene...)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337733(CHEMBL1683444 | N-((2S,4S)-1-(4-(2,4-dichlorobenzy...)
Affinity DataIC50:  1nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337733(CHEMBL1683444 | N-((2S,4S)-1-(4-(2,4-dichlorobenzy...)
Affinity DataIC50:  1nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337744(CHEMBL1683447 | N-((2S,4S)-1-(4-(2,4-dichlorophene...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337744(CHEMBL1683447 | N-((2S,4S)-1-(4-(2,4-dichlorophene...)
Affinity DataIC50:  1.10nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50167609((2R,5R)-1-[4-(2,4-Dichloro-benzyloxy)-benzenesulfo...)
Affinity DataIC50:  1.10nMAssay Description:Inhibition of human recombinant aggrecanase 1 after 150 mins by fluorescence plate readerMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345537(CHEMBL1784369 | N-(4-((4-(4-chloro-2-methylpheneth...)
Affinity DataIC50:  1.20nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345535(CHEMBL1784371 | N-(1-(cyclobutanecarbonyl)-4-((4-(...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage after 16 hrs by fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345535(CHEMBL1784371 | N-(1-(cyclobutanecarbonyl)-4-((4-(...)
Affinity DataIC50:  1.20nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345537(CHEMBL1784369 | N-(4-((4-(4-chloro-2-methylpheneth...)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage after 16 hrs by fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337730(CHEMBL1683443 | N-((2S,4S)-1-(4-(4-fluorophenyl)pi...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345534(CHEMBL1784359 | N-(4-((4-(2-cyclopropyl-4-(methyls...)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage after 16 hrs by fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345534(CHEMBL1784359 | N-(4-((4-(2-cyclopropyl-4-(methyls...)
Affinity DataIC50:  1.40nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM398042(US10322143, Compound 1 | US10323000, Compound 1 | ...)
Affinity DataIC50:  1.40nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345539(CHEMBL1784336 | N-(1-(cyclobutanecarbonyl)-4-((4-(...)
Affinity DataIC50:  1.90nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337737(CHEMBL1683459 | N-((2S,4S)-1-(4-(2-(2,5-dimethylpy...)
Affinity DataIC50:  1.90nMAssay Description:Protein concentrations were measured using the Micro BCA Protein Assay Kit (Pierce/Thermo Scientific, IL). Sample buffer was mixed with 5-25 μg ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50337737(CHEMBL1683459 | N-((2S,4S)-1-(4-(2-(2,5-dimethylpy...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage by measuring increase in fluorescence after 16 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM50345539(CHEMBL1784336 | N-(1-(cyclobutanecarbonyl)-4-((4-(...)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of ADAMTS-4 assessed as substrate cleavage after 16 hrs by fluorescence assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM194644(US9206139, 3)
Affinity DataIC50:  2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM194639(US9206139, 2)
Affinity DataIC50:  2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM194644(US9206139, 3)
Affinity DataIC50:  2nMAssay Description:Inhibition of human recombinant ADAMTS4 using synthetic peptide as substrate by FRET assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Astrazeneca

Curated by ChEMBL
LigandPNGBDBM194639(US9206139, 2)
Affinity DataIC50:  2nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 496 total ) | Next | Last >>
Jump to: