Compile Data Set for Download or QSAR
maximum 50k data
Found 310 Enz. Inhib. hit(s) with Target = 'Transcription activator BRG1'
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50539801(CHEMBL4648912 | US11840533, Compound 70)
Affinity DataKd: <1nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  10nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50158688(CHEMBL3752911)
Affinity DataKd:  21nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  36nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  47nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50182280(CHEMBL3819245)
Affinity DataKd:  49nMAssay Description:Binding affinity to human SMARCA4 expressed in BL21 (DE3)-R3-BirA cells by isothermal titration calorimetryMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50549126(CHEMBL4793170)
Affinity DataKd:  61nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  63nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394406(2-(6-amino-5-(piperazin- | US10308614, Example 7)
Affinity DataKd:  73nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  86nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50158688(CHEMBL3752911)
Affinity DataKd:  89nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50266286(CHEMBL4650213)
Affinity DataKd:  89nMAssay Description:Inhibition of human BRD4 BD1 (67 to 152 residues) preincubated for 15 mins followed by addition of C-terminal biotinylated synthetic K5,8,12,16 tetra...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50158688(CHEMBL3752911)
Affinity DataKd:  89nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by isothermal titration calorimetric analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50158688(CHEMBL3752911)
Affinity DataKd: <100nMAssay Description:Binding affinity to human SMARCA4 expressed in BL21 (DE3)-R3-BirA cells by isothermal titration calorimetryMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50549127(CHEMBL4790365)
Affinity DataKd:  100nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50469323(CHEMBL4290675)
Affinity DataKd:  280nMAssay Description:Binding affinity to His6-tagged BRG1 ATPase-SnAC (658 to 1361 residues) (unknown origin) expressed in insect sf9 cells by ITC methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184979(CHEMBL3822689)
Affinity DataKd:  417nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50598934(CHEMBL5183240)
Affinity DataKd:  510nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM220447(US10633379, Compound X | US9296741, 36)
Affinity DataKd: >1.00E+3nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184981(CHEMBL3823055)
Affinity DataKd:  2.03E+3nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50598934(CHEMBL5183240)
Affinity DataKd:  3.50E+3nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM179481(US9675697, Cpd. No. 73)
Affinity DataKd: >4.00E+3nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50366670(CHEMBL4173488)
Affinity DataKd: >5.00E+3nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOScan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184981(CHEMBL3823055)
Affinity DataKd:  5.00E+3nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM249277(US10017501, Compound 1020-18 | US9458145, 1020-18)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system after 1 hr by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50453949(CHEMBL4208820 | US11247989, Example 87)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50092310(CHEMBL3581661 | US9675697, Cpd. No. 23)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to biotinylated BRG1 (59 to 180 amino acid residues) (unknown origin) expressed in Rosetta2 cells by bio-layer interferometry methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50598935(CHEMBL5194650)
Affinity DataKd:  1.00E+4nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50148271(CHEMBL3769590)
Affinity DataKd:  1.58E+4nMAssay Description:Binding affinity to SMARCA4 in human HUT78 cell extract by chemoproteomic competition binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50504160(CHEMBL3133807 | US11773085, Compound B25)
Affinity DataKd:  1.97E+4nMAssay Description:Inhibition of human BRPF1 (627 to 740 residues) expressed in Escherichia coli BL21 after 1 hr by BROMOscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50098311(CHEMBL3590408)
Affinity DataKd:  2.00E+4nMAssay Description:Binding affinity to SMARCA4 in human HUT78 cells incubated for 45 mins by mass spectrometry based bromosphere chemoproteomic assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50455480(CHEMBL4218735)
Affinity DataKd: <3.02E+4nMAssay Description:Binding affinity to human partial length DNA-tagged SMARCA4 expressed in bacteria by BROMOscan methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50591358(CHEMBL5204703)
Affinity DataKd:  6.90E+4nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50591346(CHEMBL5188924)
Affinity DataKd:  1.42E+5nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50443232(CHEMBL3086883)
Affinity DataKi:  7.97E+3nMAssay Description:Displacement of fluorescein-labeled MS239 from recombinant human SMARCA4 bromodomain after 1 hr by fluorescence anisotropy assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184971(CHEMBL3823210)
Affinity DataIC50:  1.10E+4nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184972(CHEMBL3823525)
Affinity DataIC50:  9.60E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184973(CHEMBL3822828)
Affinity DataIC50:  6.20E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184974(CHEMBL3823057)
Affinity DataIC50:  7.30E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184975(CHEMBL3823214)
Affinity DataIC50:  6.90E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago

Curated by ChEMBL
LigandPNGBDBM50184976(CHEMBL3823365)
Affinity DataIC50:  2.20E+4nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataIC50:  21.4nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394400(2-(6-amino-5-(4-methyl- | US10308614, Example 2)
Affinity DataIC50:  296nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394401(2-(6-amino-5-(4-(pyridin- | US10308614, Example 3)
Affinity DataIC50:  37.3nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394402(1-(4-(3-amino-6-(2- | US10308614, Example 4)
Affinity DataIC50:  65.9nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394403(2-(6-amino-5-(4-((dimethylami- | US10308614, Examp...)
Affinity DataIC50:  39.5nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394405((S)-2-(6-amino-5-(2- | US10308614, Example 6)
Affinity DataIC50:  84.6nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394406(2-(6-amino-5-(piperazin- | US10308614, Example 7)
Affinity DataIC50:  214nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394407(2-(6-amino-5-(3- | US10308614, Example 8)
Affinity DataIC50:  49.8nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails US Patent
TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394408(2-(6-amino-5-((3aR,6aS)-5- | US10308614, Example 9)
Affinity DataIC50:  61.5nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
Displayed 1 to 50 (of 310 total ) | Next | Last >>
Jump to: