TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: <1nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 10nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 21nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 36nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 47nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 49nMAssay Description:Binding affinity to human SMARCA4 expressed in BL21 (DE3)-R3-BirA cells by isothermal titration calorimetryMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 61nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 63nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 73nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 86nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 89nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 89nMAssay Description:Inhibition of human BRD4 BD1 (67 to 152 residues) preincubated for 15 mins followed by addition of C-terminal biotinylated synthetic K5,8,12,16 tetra...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 89nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by isothermal titration calorimetric analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: <100nMAssay Description:Binding affinity to human SMARCA4 expressed in BL21 (DE3)-R3-BirA cells by isothermal titration calorimetryMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 100nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 280nMAssay Description:Binding affinity to His6-tagged BRG1 ATPase-SnAC (658 to 1361 residues) (unknown origin) expressed in insect sf9 cells by ITC methodMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 417nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 510nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >1.00E+3nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 2.03E+3nMAssay Description:Binding affinity to His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells by VP-ITC microcalorime...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 3.50E+3nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >4.00E+3nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >5.00E+3nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOScan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 5.00E+3nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system after 1 hr by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to human partial length SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by BROMOscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to biotinylated BRG1 (59 to 180 amino acid residues) (unknown origin) expressed in Rosetta2 cells by bio-layer interferometry methodMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 1.00E+4nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 1.58E+4nMAssay Description:Binding affinity to SMARCA4 in human HUT78 cell extract by chemoproteomic competition binding assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 1.97E+4nMAssay Description:Inhibition of human BRPF1 (627 to 740 residues) expressed in Escherichia coli BL21 after 1 hr by BROMOscan assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 2.00E+4nMAssay Description:Binding affinity to SMARCA4 in human HUT78 cells incubated for 45 mins by mass spectrometry based bromosphere chemoproteomic assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: <3.02E+4nMAssay Description:Binding affinity to human partial length DNA-tagged SMARCA4 expressed in bacteria by BROMOscan methodMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 6.90E+4nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKd: 1.42E+5nMAssay Description:Binding affinity to N-terminal His-TEV-tagged human SMARCA4 transfected in Escherichia coli BL21 (DE3) assessed as dissociation constant at 30 uM by ...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataKi: 7.97E+3nMAssay Description:Displacement of fluorescein-labeled MS239 from recombinant human SMARCA4 bromodomain after 1 hr by fluorescence anisotropy assayMore data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 1.10E+4nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 9.60E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 6.20E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 7.30E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 6.90E+3nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
TargetTranscription activator BRG1(Homo sapiens (Human))
University Of Illinois At Chicago
Curated by ChEMBL
University Of Illinois At Chicago
Curated by ChEMBL
Affinity DataIC50: 2.20E+4nMAssay Description:Inhibition of His6-tagged human recombinant SMARCA4 bromodomain expressed in Escherichia coli BL21(DE3)-R3-pRARE2 cells after 30 mins using biotinyla...More data for this Ligand-Target Pair
Affinity DataIC50: 21.4nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 296nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 37.3nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 65.9nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 39.5nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 84.6nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 214nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 49.8nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Affinity DataIC50: 61.5nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair