BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Cytochrome P450 Reductase (CPR)
Syringe Reactant:BDBM11939
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:11/07/06
 
ΔG°:-40.1± (kJ/mole)
pH:7±n/a
Log10Kb:7.26± 5.70
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-71.1±0.418 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :-0.9614±n/a (kJ/mole)
Stoich. Param.:1.1
ΔS° : -0.1023± (kJ/mole-K)
Comments:n/a
 
Citation Hoffman, JMGrunau, ASmith, AMPaine, MJRooney, CSLadbury, JEFisher, TEGutierrez, AWai, JSThomas, CMBamberger, DLBarnes, JLWilliams, TMJones, JH Global effects of the energetics of coenzyme binding: NADPH controls the protein interaction properties of human cytochrome P450 reductase. Biochemistry45:1421-34 (2006) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Cytochrome P450 Reductase (CPR)
Source:Human fibroblast CPR (lacking the N-terminal membrane-anchoring region) and the functional FAD-binding domain were expressed in Escherichia coli BL21 (DE3).
Purity:n/a
Prep. Method:The recombinant His-tagged proteins were purified to homogeneity by nickel-agarose chromatography. The notable exception is the omission of the 2,5-ADP affinity resin step to avoid the unusual biphasic binding isotherms during ITC experiment.
Name:Cytochrome P450 Reductase (CPR)
Synonyms:NADPH--cytochrome P450 reductase | P450R
Type:Enzyme
Mol. Mass.:76675.22
Organism:Homo sapiens (Human)
Description:P16435
Residue:677
Sequence:
MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTL
TSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLA
DLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWV
VEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYET
KAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPF
IGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQS
HKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVD
YIKKLMTKGRYSLDVWS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11939
Source:Sigma-Aldrich
Purity:n/a
Prep. Method:n/a
NameBDBM11939
Synonyms:NADP+ | beta-nicotinamide adenine dinucleotide phosphate, oxidized form
TypeNucleoside or nucleotide
Emp. Form.C21H29N7O17P3
Mol. Mass.744.4124
SMILESNC(=O)c1ccc[n+](c1)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](OP(O)(O)=O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O |r|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.