BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Farnesyl Diphosphate Synthase (FPPS)
Syringe Reactant:BDBM12580
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:12/13/06
 
ΔG°:-38.5± (kJ/mole)
pH:7.4±n/a
Log10Kb:6.78± n/a
Temperature:300±n/a (K)
ΔH° :n/a
ΔHobs :30.1± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.2302± (kJ/mole-K)
Comments:IC50=1.3 uM
 
Citation Yin, FCao, RGoddard, AZhang, YOldfield, E Enthalpy versus entropy-driven binding of bisphosphonates to farnesyl diphosphate synthase. J Am Chem Soc128:3524-5 (2006) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Farnesyl Diphosphate Synthase (FPPS)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Farnesyl Diphosphate Synthase (FPPS)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:41958.09
Organism:Trypanosoma brucei
Description:Q86C09
Residue:367
Sequence:
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAES
LLSLSPNNNGEEDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYR
HPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMF
DSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVT
EELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKA
NYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWG
KTYKRQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12580
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM12580
Synonyms:1-(2-hydrogen phosphonato-2-hydroxy-2-phosphonoethyl)-3-iodopyridin-1-ium | Bisphosphonate 5
TypeSmall organic molecule
Emp. Form.C7H10INO7P2
Mol. Mass.409.0088
SMILESOC(C[n+]1cccc(I)c1)(P(O)(O)=O)P(O)([O-])=O
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.