BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Thymidine Kinase (TK.dT)
Syringe Reactant:BDBM2
Meas. Tech.:ITC
Entry Date:12/13/00
 
ΔG°:-37.4±1.47 (kJ/mole)
pH:7.5±n/a
Log10Kb:n/a
Temperature:283.15±n/a (K)
ΔH° :-49.1±2.46 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:yes
Protons Released:-0.31
ΔCp :-0.588±0.084 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.042±0.220 (kJ/mole-K)
Comments:n/a
 
Citation Perozzo, RJelesarov, IBosshard, HRFolkers, GScapozza, L Compulsory order of substrate binding to herpes simplex virus type 1 thymidine kinase. A calorimetric study. J Biol Chem275:16139-45 (2000) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Thymidine Kinase (TK.dT)
Source:n/a
Purity:More than 99% of the enzyme was present as TK.dT complex
Prep. Method:0.0373 mM enzyme exists in the presence of 1 mM dT.
Name:Thymidine Kinase (TK.dT)
Synonyms:thymidine kinase and thymidine complex (TK.dT)
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Thymidine kinase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:40978.57
Organism:Human herpesvirus 1
Description:P03176
Residue:376
Sequence:
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQEATEVRPEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRSMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPT
ICDLARTFAREMGEAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
NameBDBM1
Synonyms:dT | thymidine
TypeNucleoside or nucleotide
Emp. Form.C10H14N2O5
Mol. Mass.242.2286
SMILESCc1cn([C@H]2C[C@H](O)[C@@H](CO)O2)c(=O)[nH]c1=O
Structure
BDBM2
Source:Sigma
Purity:n/a
Prep. Method:n/a
NameBDBM2
Synonyms:({[({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy](hydroxy)phosphoryl}oxy)phosphonic acid | ATP | Brimonidine ATP | CHEMBL14249
TypeNucleoside or nucleotide
Emp. Form.C10H16N5O13P3
Mol. Mass.507.181
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.