BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Ab N1G9
Syringe Reactant:BDBM13
Meas. Tech.:ITC
Entry Date:12/04/00
 
ΔG°:-40.3±0.420 (kJ/mole)
pH:8±n/a
Log10Kb:5.08± 4.30
Temperature:307.85±n/a (K)
ΔH° :-61.7± (kJ/mole)
ΔHobs :-61.7± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :-1.298±0.113 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.069±0.0160 (kJ/mole-K)
Comments:n/a
 
Citation Torigoe, HNakayama, TImazato, MShimada, IArata, YSarai, A The affinity maturation of anti-4-hydroxy-3-nitrophenylacetyl mouse monoclonal antibody. A calorimetric study of the antigen-antibody interaction. J Biol Chem270:22218-22 (1995) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Ab N1G9
Source:Purified from C57BL/6 mice hybridoma cell lines
Purity:n/a
Prep. Method:n/a
Name:Ab N1G9
Synonyms:3B62 | N1G9
Type:Antibody
Mol. Mass.:47156.21
Organism:Mus musculus (mouse)
Description:Anti-4-hydroxy-3-nitrophenylacetyl mouse monoclonal antibody
Residue:437
Sequence:
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRDCQAVVTQESALTTSPGETV
TLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTIT
GAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCT
ITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQV
THEGHTVEKSLSRADCS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13
Source:n/a
Purity:n/a
Prep. Method: Synthesized from 4-hydroxy-3-nitrophenylacetic acid and -amino-n-caproic acid
NameBDBM13
Synonyms:4-hydroxy-3-nitrophenylacetyl (NP) caproic | 6-[1-(4-hydroxy-3-nitrophenyl)acetamido]hexanoic acid
TypeSmall organic molecule
Emp. Form.C14H18N2O6
Mol. Mass.310.3025
SMILESOC(=O)CCCCCNC(=O)Cc1ccc(O)c(c1)[N+]([O-])=O
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.