BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Outer Membrane Phospholipase A
Syringe Reactant:BDBM14
Meas. Tech.:ITC, Equilibrium Gel Filtration, and Fluorescence
Entry Date:12/11/00
 
ΔG°:-27.3± (kJ/mole)
pH:8.3±n/a
Log10Kb:4.66± n/a
Temperature:303±n/a (K)
ΔH° :-83.2± (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.1848± (kJ/mole-K)
Comments:n/a
 
Citation Ubarretxena-Belandia, IBoots, JWVerheij, HMDekker, N Role of the cofactor calcium in the activation of outer membrane phospholipase A. Biochemistry37:16011-8 (1998) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Outer Membrane Phospholipase A
Source:Expressed in E.coli
Purity:n/a
Prep. Method:Purified protein was modified with hexadecanesulfonylfluoride in buffer for 1 hr at room temperature
Name:Outer Membrane Phospholipase A
Synonyms:Outer Membrane Phospholipase A (sulfonylated) | Phospholipase A (OMPLA) | Phospholipase A (OMPLA), sulfonylated
Type:Enzyme
Mol. Mass.:33712.17
Organism:Pantoea agglomerans
Description:Q9Z4N8
Residue:292
Sequence:
MGRFWQILIALLLVPTLAQAEEATVEKIHDAPTVRGSIIAAMLQDHDNPFLLYPYETNYL
LYTYTSDINKDAISSYDWAQNAKKDEVKFQLSLGFPIWRGIAGDNSLLGASYTQRSWWQA
SNSDESSPFRETNYEPQIFLAWATDYELAGWTFREVEFGYNHQSNGKADPTSRSWDRVYT
RLMAQRGNLEIDLKPWYRIPESDSKDDNPDINKYMGYYRLKVGYALGESVFSIDGRYNWN
TGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14
Source:n/a
Purity:n/a
Prep. Method:dissolved in water
NameBDBM14
Synonyms:Ca2+ | calcium
TypeMetal Ion
Emp. Form.Ca
Mol. Mass.40.077
SMILES[Ca++]
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.