BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Transcriptional Regulator TtgR-DNA
Syringe Reactant:BDBM19461
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:07/23/08
 
ΔG°:-29.1±0.0836 (kJ/mole)
pH:7±n/a
Log10Kb:5.03± 3.48
Temperature:303.15±n/a (K)
ΔH° :n/a
ΔHobs :-59.4±0.711 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0997±0.00290 (kJ/mole-K)
Comments:n/a
 
Citation Terán, WKrell, TRamos, JLGallegos, MT Effector-repressor interactions, binding of a single effector molecule to the operator-bound TtgR homodimer mediates derepression. J Biol Chem281:7102-9 (2006) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Transcriptional Regulator TtgR-DNA
Source:TtgR protein was over-expressed and purified from E. coli. DNA fragment was obtained by annealing two complementary oligonucleotides.
Purity:n/a
Prep. Method:Purified TtgR was placed into the ITC cell and titrated by the addition of the 40-bp DNA fragment. The completeness of protein saturation with DNA was verified by polyacrylamide gel electrophoresis.
Name:Transcriptional Regulator TtgR-DNA
Synonyms:n/a
Type:DNA Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Transcriptional Regulator TtgR
Synonyms:HTH-type transcriptional regulator ttgR | Toluene efflux pump ttgABC operon repressor
Type:Repressor; homodimer
Mol. Mass.:23852.57
Organism:Pseudomonas putida
Description:n/a
Residue:210
Sequence:
MVRRTKEEAQETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQSAVLDCHKGITLALANAVRRGQLPGELDAERAAVAMFAYVDGLIRRWLL
LPDSVDLLGDVEKWVDTGLDMLRLSPALRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:TtgR Operator-Containing DNA Fragment
Synonyms:n/a
Type:Duplex DNA
Mol. Mass.:3377.80
Organism:n/a
Description:n/a
Residue:40
Sequence:
5-CAGCAGTATTTACAAACAACCATGAATGTAAGTATATTCC-3
 
BDBM19461
Source:n/a
Purity:n/a
Prep. Method:All chemicals were manipulated in glass vessels and effector samples were neither degassed nor filtered, to avoid evaporation or nonspecific binding.
NameBDBM19461
Synonyms:α-CA inhibitor, 5 | 5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one | CHEMBL32571 | Naringenin | Naringenin (NAR) | naringetol | salipurpol
TypeEstrgen Antagonist
Emp. Form.C15H12O5
Mol. Mass.272.2528
SMILESOc1ccc(cc1)C1CC(=O)c2c(O)cc(O)cc2O1
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.