Cell Reactant:
Heat Shock Protein 90 (Hsp90)
Syringe Reactant:
BDBM18134
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
09/29/09
ΔG°:
-22.8±n/a (kJ/mole)
pH:
8±n/a
Log10Kb:
3
Temperature:
288.15±n/a (K)
ΔHobs :
-35.9±0.3 (kJ/mole)
Corrected for ΔHioniz:
no
ΔS° :
-0.0455±n/a (kJ/mole-K)
Citation
 Nilapwar, SWilliams, EFu, CProdromou, CPearl, LHWilliams, MALadbury, JE Structural-thermodynamic relationships of interactions in the N-terminal ATP-binding domain of Hsp90. J Mol Biol 392:923-36 (2009) [PubMed]  Article
Cell React
Source:
His-tagged N-terminal domain of yeast HSP90 was expressed and purified.
Prep. Method:
Protein was purified by using nickel affinity column, and was subsequently concentrated by an (NH4)2SO4 precipitation and purified further using gel filtration chromatography.
Name:
Heat Shock Protein 90 (Hsp90)
Synonyms:
82 kDa heat shock protein | ATP-dependent molecular chaperone HSP82 | Heat shock protein Hsp90 heat-inducible isoform
Type:
N-terminal domain
Mol. Mass.:
23389.88
Organism:
Saccharomyces cerevisiae (Baker s yeast)
Description:
P02829 aa 1-207
Residue:
207
Sequence:
MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQL
  
Syringe React
Name:
BDBM18134
Synonyms:
({[({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy](hydroxy)phosphoryl}amino)phosphonic acid | 5-Adenylyl imidodiphosphate | AMP.P[NH]P | AMPPNP
Type:
Nucleoside or nucleotide
Emp. Form.:
C10H17N6O12P3
Mol. Mass.:
506.1963
SMILES:
Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)NP(O)(O)=O)[C@@H](O)[C@H]1O |r|
Structure:
Search PDB for entries with ligand similarity: