Cell Reactant:
HIV-1 Protease B Subtype
Syringe Reactant:
BDBM580
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
06/22/04
ΔG°:
-62.282±n/a (kJ/mole)
pH:
5±n/a
Log10Kb:
9.6
Temperature:
298.15±n/a (K)
ΔH° :
-33.44±n/a (kJ/mole)
ΔHobs :
-33.44±n/a (kJ/mole)
Corrected for ΔHioniz:
not known
ΔS° :
0.0968±n/a (kJ/mole-K)
Comments:
In displacement titration, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor acetylpepstatin.
Citation
 Velazquez-Campoy, AVega, SFreire, E Amplification of the effects of drug resistance mutations by background polymorphisms in HIV-1 protease from African subtypes. Biochemistry 41:8613-9 (2002) [PubMed]  Article
Cell React
Source:
Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:
99%
Prep. Method:
HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:
HIV-1 Protease B Subtype
Synonyms:
n/a
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
n/a
Components:
This complex has 2 components.
Component 1
Name:
Gag-Pol polyprotein [489-587,Q496K]
Synonyms:
HIV-1 Protease (Q7K) chain A | HIV-1 Protease (Q7K) chain B | HIV-1 Protease B Subtype chain A | HIV-1 Protease B Subtype chain B | HIV-1 Protease Mutant (Q7K) | HIV-1 Protease chain A
Type:
Enzyme Subunit
Mol. Mass.:
10782.21
Organism:
Human immunodeficiency virus type 1
Description:
All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:
99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
  
Component 2
Name:
Gag-Pol polyprotein [489-587,Q496K]
Synonyms:
HIV-1 Protease (Q7K) chain A | HIV-1 Protease (Q7K) chain B | HIV-1 Protease B Subtype chain A | HIV-1 Protease B Subtype chain B | HIV-1 Protease Mutant (Q7K) | HIV-1 Protease chain A
Type:
Enzyme Subunit
Mol. Mass.:
10782.21
Organism:
Human immunodeficiency virus type 1
Description:
All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:
99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
  
Syringe React
Source:
From Dr. Kiso, Department of Medicinal Chemistry, Kyoto Pharmaceutical University, Kyoto, Japan).
Prep. Method:
were used without further purification
Name:
BDBM580
Synonyms:
(4R)-3-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-phenylbutanoyl]-5,5-dimethyl-N-[(2-methylphenyl)methyl]-1,3-thiazolidine-4-carboxamide | AG1776 | JE-2147 | KNI-764
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity: