Cell Reactant:
Purine nucleoside phosphorylase
Syringe Reactant:
BDBM50246593
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
03/18/13
pH:
7.4±0
Temperature:
300.15±0 (K)
ΔH° :
-84.6±0.8 (kJ/mole)
Citation
 Edwards, AAMason, JMClinch, KTyler, PCEvans, GBSchramm, VL Altered enthalpy-entropy compensation in picomolar transition state analogues of human purine nucleoside phosphorylase. Biochemistry 48:5226-38 (2009) [PubMed]  Article
Cell React
Name:
Purine nucleoside phosphorylase
Synonyms:
Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:
Enzyme
Mol. Mass.:
32119.53
Organism:
Homo sapiens (Human)
Description:
n/a
Residue:
289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
  
Syringe React
Name:
BDBM50246593
Synonyms:
7-((1,3-dihydroxypropan-2-ylamino)methyl)-3H-pyrrolo[3,2-d]pyrimidin-4(5H)-one | 7-({[2-hydroxy-1-(hydroxymethyl)ethyl]amino}methyl)-3,5-dihydro-4H-pyrrolo[3,2-d]pyrimidin-4-one | CHEMBL505564 | Immucillins, 4
Type:
Small organic molecule
Emp. Form.:
C10H14N4O3
Mol. Mass.:
238.2432
SMILES:
OCC(CO)NCc1c[nH]c2c1nc[nH]c2=O
Structure:
Search PDB for entries with ligand similarity: